KEGG   Alteromonas macleodii AltDE1: amad1_18005Help
Entry
amad1_18005       CDS       T02340                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    amad1_18005
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    amad1_18005
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    amad1_18005
Enzymes [BR:amaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     amad1_18005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4082240..4083934
Genome map
AA seq 564 aa AA seqDB search
MDRRTFIRLSSFAGASVAVSTGLAGCTVSTSANSQPQTKSEFTHGVASGDPLKDAVIIWT
RAVPTSSSALVKADILWEMASDAAFTDVVSSGVVEAKATHDFTVKVDVSGLQPASKYFYR
FKSANNVSPVGETRTLPEADVSKVTFGIFSCSNYPAGFFTPYMEAAKDDNMDYVLHLGDY
IYEYDGKGYATEHAKEIGRTYAPDNDTELYTLTDYRNRYALYRTDEGLLALHQNKPFIVV
WDDHEITNDTYKDGAENHQADEGDFYERRAAAVQAYYEWLPIRPPFGTERLEIYRQFTFG
NLLDLYMLDTRVLARDKQLEYANYRDAETKAFDQAGFMKDISDPSRGLLGETQRNWLHSS
MQQSQAKWQVLGQQLLIGRMLFPVSIFNGVERKEIPAHVHRLANIKRKQKQGAALSEQEL
ALINTVMPYNLDAWDGYPVEREQVLMQLKSIGKPVIALAGDTHNAWHNKLTLKDGTEVGV
ELATSGVTSPGMEHYLSMDDEMAETLADDLPLLIDDLQYCNLHQRGFMTLTVSEDEAKAT
WHYVDAILTKAGKVVNTHSFEIKA
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggatagaagaacgtttattaggctgtcgtcattcgcgggtgcgagcgtggcagtatct
actgggctagcggggtgtacagttagcacgtcagcaaacagtcagcctcaaactaaatcg
gaatttacccatggcgtggccagtggcgacccgttaaaagatgcagtgatcatttggact
cgcgcggttcctacatcaagctcggctttagttaaagccgatattttgtgggaaatggca
agcgatgcagcatttaccgacgtggtaagtagcggagtcgttgaggctaaagcgacacat
gactttaccgtaaaagtagatgtgtcaggtcttcagcctgcaagcaaatacttttatcgc
ttcaaaagtgcgaataatgtaagccctgttggcgaaactcgtacattgccggaagcagac
gtatctaaggtcacattcggcatattttcttgctcgaactaccctgccggctttttcacg
ccttatatggaagccgccaaagatgacaacatggattatgtactgcatttgggcgactac
atatatgagtacgatggaaagggttacgccaccgaacatgccaaagagattggccgaacc
tatgcgccagataacgataccgagctatatacgctaaccgactaccgaaaccgctacgcg
ttgtatcgcaccgacgaagggttgcttgcgctgcatcaaaacaagccttttattgtggtt
tgggatgatcacgaaattactaacgacacttacaaagacggtgcggaaaatcaccaagca
gacgaaggtgatttttatgaacgtcgcgctgcggcagtgcaagcctattatgagtggctg
cctattcgcccaccatttggcactgaacgtttagaaatctaccgtcagtttacctttggc
aacctgcttgatttatacatgcttgatacccgcgttttagcccgggataagcagcttgaa
tacgccaactatcgcgacgctgaaactaaagcttttgaccaagcaggctttatgaaagat
atcagtgatcctagtcgtgggcttttaggtgaaacccagcgcaactggctgcattcatct
atgcagcaaagtcaggcaaaatggcaggtgttaggccaacagctattaataggccgcatg
cttttccctgtatcgatatttaacggcgttgagcgtaaagaaatacctgctcatgtacat
aggcttgcgaatatcaaacgcaaacaaaagcaaggtgcagcactcagtgagcaagagctt
gcacttatcaatacggtaatgccctacaatttagacgcatgggacggctaccccgttgaa
cgggaacaggttctcatgcagctaaaatccatcggcaaacccgttatagctctagcaggc
gatactcataatgcatggcacaataagttaaccctcaaagacggaacggaagtgggtgtt
gaacttgccacctctggggtgacgtcacccggcatggaacattatttaagtatggatgat
gaaatggcagaaacacttgctgatgaccttccccttcttattgatgatttacagtattgt
aatcttcaccagcgcggctttatgacattgaccgttagcgaggatgaagctaaagcgacc
tggcactatgtggatgcgattttgaccaaggctggaaaggtggttaacacgcatagcttt
gagattaaggcatag

DBGET integrated database retrieval system