KEGG   Apis mellifera (honey bee): 412027Help
Entry
412027            CDS       T01057                                 

Gene name
pr-set7, GB15777
Definition
histone-lysine N-methyltransferase pr-set7
Orthology
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
ame  Apis mellifera (honey bee)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ame00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG8
AA seq 386 aa AA seqDB search
MRKINSVFVHYMKKSRDNMVKGRRKRVQTKNTGRTKVNVLSIQNDINQSSMKKEIKLDDT
KNVKKVNSDEIHSTHKSSVCISSFFYTQITDISKNKTSIAPIEERFYRSEEINTVQNDIL
TDVGHFRTDETPVAVPIHSPSTPHRINMPNDQCEDLDERNTNDNKSKKSIAPTLHLEQQI
SKKPPNRGRRKLNNNHSSAIYALDSTNIKSTNHKLTDYFPVRRSVRKSKKAVLEEKQRDM
ENKVLCQVEEGLEVRHFAGKGRGIVTTREFMKGEFVVEYIGELIDQVTAKKREKIYALDQ
NTGCYMYYFQHRNHQYCVDATAETNKLGRLVNHSRNGNLIARVIEVESTPHLVLTAKENI
SIGVEVTYDYGDRSREAIRHHPWLAL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaataaattcagtatttgttcattatatgaaaaaatcaagggataatatggtg
aaaggacggcgaaaacgtgtgcaaacaaaaaatacaggtcgtacaaaagttaatgtttta
tccattcaaaacgacataaatcaatcatcaatgaaaaaggaaatcaaactagatgatact
aaaaatgtaaaaaaagttaattcagatgaaattcattcaacacataagtcatctgtatgc
ataagttcctttttttatacacaaattacagatatttctaaaaataaaacttctatagcg
cctattgaagaaaggttttatagaagtgaagaaatcaatacagtacaaaatgatattctt
actgatgttggtcattttagaacagatgaaacacctgtagcagtacctatacatagtcca
tcaacaccgcacagaattaatatgccaaatgatcaatgtgaagacttagatgaaagaaat
acaaatgataataagtctaaaaagtctatagctccaacacttcatttagaacaacaaatt
tcaaaaaaacctcctaaccgtggccgtagaaaattaaataataatcattctagtgcaatt
tatgcattagattctacaaatatcaaaagtacaaatcataagcttactgactactttcca
gtacgtcgtagtgtcaggaaatctaagaaagctgtattagaagaaaaacaacgtgatatg
gaaaacaaagtgctgtgtcaagtagaggaaggtttagaagtaagacattttgctggtaaa
ggtcgtggaatagtaacaacgcgagaatttatgaaaggagaatttgtagtagaatatatt
ggtgaattaattgatcaagtaacagcaaagaaacgtgaaaaaatatatgcactagaccaa
aatactggatgttatatgtattattttcaacatcgtaatcatcagtattgcgttgatgca
acagcagaaactaataagttaggtagattagtaaaccattcaagaaatggtaatttaatt
gcacgagtcatagaagtagaatcgacacctcatctggtacttacagcaaaagaaaatata
tctattggggtagaagtaacatatgactatggagatcgaagtcgcgaagctattcgtcat
catccatggttggcattatag

DBGET integrated database retrieval system