KEGG   Apis mellifera (honey bee): 412027Help
Entry
412027            CDS       T01057                                 

Gene name
pr-set7, GB15777
Definition
histone-lysine N-methyltransferase pr-set7
Orthology
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
ame  Apis mellifera (honey bee)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    412027 (pr-set7)
Enzymes [BR:ame01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     412027 (pr-set7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG8
AA seq 386 aa AA seqDB search
MRKINSVFVHYMKKSRDNMVKGRRKRVQTKNTGRTKVNVLSIQNDINQSSMKKEIKLDDT
KNVKKVNSDEIHSTHKSSVCISSFFYTQITDISKNKTSIAPIEERFYRSEEINTVQNDIL
TDVGHFRTDETPVAVPIHSPSTPHRINMPNDQCEDLDERNTNDNKSKKSIAPTLHLEQQI
SKKPPNRGRRKLNNNHSSAIYALDSTNIKSTNHKLTDYFPVRRSVRKSKKAVLEEKQRDM
ENKVLCQVEEGLEVRHFAGKGRGIVTTREFMKGEFVVEYIGELIDQVTAKKREKIYALDQ
NTGCYMYYFQHRNHQYCVDATAETNKLGRLVNHSRNGNLIARVIEVESTPHLVLTAKENI
SIGVEVTYDYGDRSREAIRHHPWLAL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaataaattcagtatttgttcattatatgaaaaaatcaagggataatatggtg
aaaggacggcgaaaacgtgtgcaaacaaaaaatacaggtcgtacaaaagttaatgtttta
tccattcaaaacgacataaatcaatcatcaatgaaaaaggaaatcaaactagatgatact
aaaaatgtaaaaaaagttaattcagatgaaattcattcaacacataagtcatctgtatgc
ataagttcctttttttatacacaaattacagatatttctaaaaataaaacttctatagcg
cctattgaagaaaggttttatagaagtgaagaaatcaatacagtacaaaatgatattctt
actgatgttggtcattttagaacagatgaaacacctgtagcagtacctatacatagtcca
tcaacaccgcacagaattaatatgccaaatgatcaatgtgaagacttagatgaaagaaat
acaaatgataataagtctaaaaagtctatagctccaacacttcatttagaacaacaaatt
tcaaaaaaacctcctaaccgtggccgtagaaaattaaataataatcattctagtgcaatt
tatgcattagattctacaaatatcaaaagtacaaatcataagcttactgactactttcca
gtacgtcgtagtgtcaggaaatctaagaaagctgtattagaagaaaaacaacgtgatatg
gaaaacaaagtgctgtgtcaagtagaggaaggtttagaagtaagacattttgctggtaaa
ggtcgtggaatagtaacaacgcgagaatttatgaaaggagaatttgtagtagaatatatt
ggtgaattaattgatcaagtaacagcaaagaaacgtgaaaaaatatatgcactagaccaa
aatactggatgttatatgtattattttcaacatcgtaatcatcagtattgcgttgatgca
acagcagaaactaataagttaggtagattagtaaaccattcaagaaatggtaatttaatt
gcacgagtcatagaagtagaatcgacacctcatctggtacttacagcaaaagaaaatata
tctattggggtagaagtaacatatgactatggagatcgaagtcgcgaagctattcgtcat
catccatggttggcattatag

DBGET integrated database retrieval system