KEGG   Alteromonas macleodii English Channel 673: AMEC673_17790Help
Entry
AMEC673_17790     CDS       T02254                                 

Definition
(GenBank) alternative dihydrofolate reductase
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg00670  One carbon pool by folate
amg00790  Folate biosynthesis
amg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AMEC673_17790
   00670 One carbon pool by folate
    AMEC673_17790
Enzymes [BR:amg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AMEC673_17790
    1.5.1.50  dihydromonapterin reductase
     AMEC673_17790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_10 Epimerase NmrA RmlD_sub_bind YcaO
Motif
Other DBs
NCBI-ProteinID: AFT76236
UniProt: A0A0E0YGM1
Position
4184582..4185289
Genome map
AA seq 235 aa AA seqDB search
MNSPVLITGASQRLGLAMANSLLDQGHHVVVTYRTLRPSISMLEDKGATVLQADFSTEAA
IDRAIDEIKAISKTYRAVIHNASDWAQEKDNHDKHSLIERMMLVHAVAPYRINLALEKAL
CDCDVQSDIIHMTDYVQETGSEKHMAYAASKAALHNLTLSFAKKLAPKVKVNSIAPALLM
FNEGDDEAYKQKALEKSLLEIVPGAQEAVKAVNYLFDSDYVTGQTLHLNGGRHLK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
ttgaattcacctgtgttaattacaggcgcaagtcaacgtttaggcttagctatggccaat
agtttacttgaccagggccaccacgttgtcgtgacttatcgaacacttcgtccaagtatt
tcaatgcttgaggataaaggtgctacagtcttacaggcggattttagcactgaggcggct
attgatcgagcaattgatgagattaaggcaatcagtaaaacctatcgagcggtgatccac
aacgcgtcagattgggcgcaagaaaaagataaccatgacaagcatagcttgattgaacga
atgatgttggtccatgctgttgccccttaccgcataaacttggcacttgaaaaggctctt
tgtgattgcgacgttcaatctgacattattcatatgactgactacgttcaagaaacaggc
agcgagaaacacatggcttatgcggcaagtaaggcagccctgcacaacctgaccctatca
tttgctaagaagctagcaccaaaggtaaaagtaaatagcattgccccagctttgcttatg
ttcaatgagggtgatgacgaagcttataagcaaaaagcgttagaaaaatcactgttagag
atagtaccgggggcgcaagaggccgtgaaagccgtgaactatttatttgatagtgactat
gtgacagggcaaacccttcacctcaacggtgggcggcatttaaaataa

DBGET integrated database retrieval system