KEGG   Alteromonas macleodii English Channel 615: I633_08705Help
Entry
I633_08705        CDS       T02719                                 

Definition
Kynureninase
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
amh  Alteromonas macleodii English Channel 615
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amh00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    I633_08705
Enzymes [BR:amh01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     I633_08705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1745652..1746887
Genome map
AA seq 411 aa AA seqDB search
MINRVFSAEQLDDKDPLAHKAGAFSLPDNTIYLDGNSLGPLPKSAEKRAVEVVQEQWGQG
LITSWNKHQWISLPQQVGDKIGELIGAQQGQVICCDSISINLFKVLSAALKMNPRRKVIA
TTRDNFPTDIYMIQGLLDLLGEEYSIRYVDEASISSQLTDDIAVLMLTQVNFRSGLKLDM
KGITEQAHAKGILTLWDLAHSAGAFPVCLDDCNVDFAVGCSYKYLNGGPGAPAFIYVARR
HQDSYQQPLSGWMGHSAPFSFSPDYAPDKSVKQNLCGTPGVIGMSILDAALDVFDDVSLK
AIDEKSKKLQAFFIAEAKRAGVLEHFGVASPPINCRGSQLALAHDEAYAICQAWIAEGVI
ADFRAPNILRIGFAPLYLSFADVEKAVTRLAIIMNEKRYENATFQQRQSVT
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgattaatagggttttttccgctgagcaacttgatgacaaggacccgcttgcacacaaa
gccggggctttttcgcttccagacaacaccatctatttagacggtaattctcttggccct
ttaccgaaatcagcagaaaagcgagcggttgaagtagttcaagagcaatgggggcaaggc
cttattacaagttggaacaaacaccagtggatttccttacctcaacaagtcggcgacaaa
ataggggagcttataggcgcgcaacagggccaggtcatctgctgtgactctatctctatt
aacttatttaaagtgttaagcgccgcgcttaaaatgaacccaaggcgcaaagtaattgcg
accacacgtgataattttccaaccgatatctatatgattcaagggttgttagatttactt
ggcgaagagtacagtatccgctatgtagatgaagccagtattagtagccagttaaccgat
gatattgccgtgcttatgcttacgcaggttaactttcgaagtgggcttaagcttgatatg
aaaggcattaccgagcaagcacatgcaaaagggattttgacgttgtgggatcttgcccat
agtgccggcgctttcccagtatgcttggatgattgcaacgtagattttgccgtagggtgt
tcgtacaagtatttaaacggcggccccggcgcgccagcatttatttatgttgcgcgccgt
catcaagatagctatcagcagcccctgtctggatggatgggacacagtgcccctttttca
ttttctcccgactacgcgccagataaatcggtaaagcaaaacttgtgcggtacgcccggt
gttataggcatgagtatattggatgcggcattagacgtttttgacgatgtgtcactgaaa
gccatcgacgagaagtcgaaaaagcttcaagctttttttattgctgaagcaaaaagggca
ggggtgttagaacatttcggtgtggcgagcccaccgattaattgccggggtagccaattg
gccctcgcccacgatgaggcttatgccatttgccaagcgtggattgctgaaggggtgatc
gctgacttccgcgcgcctaatattttgcgaatagggtttgcgccgctttatttgagcttc
gccgatgtcgaaaaggcggtaacaagacttgcaattatcatgaacgaaaaacgttatgaa
aatgcgacattccagcaaagacagagcgttacctga

DBGET integrated database retrieval system