KEGG   Actinosynnema mirum: Amir_2005Help
Entry
Amir_2005         CDS       T00957                                 

Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ami  Actinosynnema mirum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Amir_2005
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Amir_2005
   00630 Glyoxylate and dicarboxylate metabolism
    Amir_2005
Enzymes [BR:ami01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Amir_2005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2221163..2222728)
Genome map
AA seq 521 aa AA seqDB search
MHEYRGTEVVGASGDRFDEILTPEAVAFVARLDDRFAARRAELLAERRQRREEFAAGAVP
DFLAETAHVRDDPSWRVAPVAPGLAERQVEITGPPDRKRALNALNSGARVWMADFEDATS
PTWRNLVSGQVNLLDAVEGRIEFTAEGGKRYELGGSPATIVVRPRGWHLVEKHLIVGGRP
VSASLFDFGLFLFHCGRRLVERGLGPYFYLPKLEGHREARLWNDVFLFAQEELGLPRGTI
RATVLIETITAAFEMEEILHELREHSSGLNAGRWDYVFSVVKNFGDRPGFVLPDRARVTM
EAPFLRAYTELLVRTCHKRGAHAIGGMAAFVPSRDAEANAVALDAVAADKRREAGDGFDG
SWVAHPGLVGVCAAAFPRPDQLDRLREDVAVTGADLLAVDRTPGRVTEAGLRGNVSVAVR
YLESWLSGVGAAAIGGLMEDAATAEISRCQVWQWVRHGTPLAEGGVVGEGLVREVLEKEL
LEVAPERREAVREVFVENALAERLPLFFTTRAYARHLAGRG
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgagtaccgcgggaccgaggtcgtcggggcgtccggcgaccggttcgacgagatc
ctgaccccggaggcggtcgcgttcgtggcgcggctggacgaccggttcgccgcccggcgc
gcggagctgctggccgagcggcggcagcggcgggaggagttcgcggccggggccgtcccg
gacttcctggccgagaccgcgcacgtcagggacgacccgtcgtggcgggtggcgccggtc
gcgccggggctggcggagcggcaggtggagatcaccgggccgccggaccggaagagggcg
ctgaacgcgctcaactccggggcgcgggtgtggatggcggacttcgaggacgccacctcg
ccgacgtggcggaacctggtgtccggccaggtgaacctgctcgacgcggtggaggggcgg
atcgagttcaccgcggagggcgggaagcgctacgagctgggcggctcgcccgcgacgatc
gtggtgcgaccacgcgggtggcacctggtggagaagcacctgatcgtcggcgggcgaccg
gtgtcggcctcgctgttcgacttcgggctgttcctgttccactgcggacggaggttggtg
gagcgcggtctcgggccgtacttctacctgccgaagctggaggggcaccgggaggcgcgg
ctgtggaacgacgtcttcctgttcgcgcaggaggagctggggctgccgcgcgggacgatc
cgggcgacggtgctgatcgagacgatcacggcggcgttcgagatggaggagatcctgcac
gagctgcgggagcacagctcggggctcaacgcggggcggtgggactacgtcttcagcgtg
gtcaagaacttcggggaccggccggggttcgtcctgcccgaccgggcgcgggtgaccatg
gaggcgccgttcctgcgggcctacaccgagctgctggtgcgcacctgccacaagcggggg
gcgcacgcgatcggcgggatggcggcgttcgtgccgagccgggacgccgaggcgaacgcg
gtggcgctggacgcggtcgcggcggacaagcggcgcgaggccggggacgggttcgacggg
tcgtgggtggcgcaccccggtctggtcggggtgtgcgcggcggcgttcccccggcccgac
cagctggaccggctgcgggaggacgtggcggtgaccggcgcggacctgctggcggtggac
cggacccctgggcgggtgaccgaggccgggctgcgcgggaacgtgtcggtcgcggtgcgg
tacctggagtcgtggctgtccggggtgggcgcggcggcgatcggcgggctgatggaggac
gcggccacggcggagatctcgcgctgccaggtgtggcagtgggtgcggcacgggacgccg
ctcgccgagggcggggtggtcggcgaggggctggtgcgggaggtgctggagaaggagctg
ctggaggtggccccggagcggcgggaggcggtgcgggaggtgttcgtggagaacgcgctg
gcggagcggctgccgctgttcttcacgaccagggcttacgcgcggcacctggccggtcgc
gggtag

DBGET integrated database retrieval system