KEGG   Advenella mimigardefordensis: MIM_c09360Help
Entry
MIM_c09360        CDS       T03016                                 

Gene name
ppc
Definition
phosphoenolpyruvate carboxylase (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
amim  Advenella mimigardefordensis
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:amim00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MIM_c09360 (ppc)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MIM_c09360 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MIM_c09360 (ppc)
   00680 Methane metabolism
    MIM_c09360 (ppc)
Enzymes [BR:amim01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MIM_c09360 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(1055653..1058514)
Genome map
AA seq 953 aa AA seqDB search
MDNVDNASTDRNEMQQDIRLLGRILGAAIRESEGQPIFDVIETVRRAAVRFKREGIPQER
DTMINKLTALSDEQANTLSRAFSYFLHLANLAEDRDQQKRQRRRLLSRNDPQTGTLGHTL
TELERHGVQHSQVRDFLAKTMIVPVLTAHPTEVQRKSTLDLHRHISQCLVDLDSRLTEEE
SHQLALALTGYIKTLWLTRMLRFNKLTVNDEIENAVAYFNTTFLKAIPTLYTTFARKLGG
PPDNAALMPTFLKMGSWIGGDRDGNPNVNADTLTHAMNRHATTLFEYYLSQIHLLGSELS
LSTSLTQVSPELASLSDNSPDQSRHRLDEPYRRALIGVYARLAATAKHLTAHDLALRNTV
PAEPYADPAAFAADLAVIARSLCDNHAAAVVPLRLQELQQAVAVFGFHLAALDLRQSSDV
HERILTELYQRAAIKYDGKPVQYDQLDEERKIALLLAELDDSRPLVSPWQQYSEETRKEL
AILQAAATVRRHYGHHAITQYIVSHTETLSDLLEVLVLQQETGLISQQRDDSGQRLPVTH
GDGLIVVPLFETIPDLEAGPAIMDRWLALPQVRERVIHAQDNIQEVMLGYSDSNKDGGYL
TSNWSLYNAELQLLEVFRRHDVRLRLFHGRGGSVGRGGGSSFDAILAQPPGTVDGQIRLT
EQGEVIQTKYKNAESGRVNLELLVSATLLSSLAPHEETRKDAETLQRYTQAMAWLSDTAQ
HAYRRLVYDTPGFVEYFFAATPINEIAGLNIGSRPASRKKGQRIEDLRAIPWGFSWAQCR
LMITGWYGVGTAIDTFIRLGTGKDDGSTPQSRTQLLRDMAAHWPFFQTVLSNMEMVLAKT
DMDIGRQYSELVADQQIRSTIFGMIEKEFGLTRDALFSIKQQDLLADNQPLKAALQERFA
YTDPLNYLQVEVIRRQRALEDAEEEPSKLEQVRSQRTIHLTINGIATGLRNSG
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
gtggacaacgtggacaacgcaagcacagacagaaatgaaatgcagcaggacattcggctg
ctgggcaggatccttggggcagctattcgggaatcggagggccagccgatttttgacgtc
attgaaacggtgcgccgcgccgcggtacgcttcaaacgggaaggaatcccgcaagaacgc
gataccatgatcaacaagctgacagccttgtccgatgaacaggccaataccctgtcgcgt
gccttcagctacttcctgcatctggccaacctggcagaagaccgggatcagcaaaagcgc
cagcgccgcaggttgctcagcaggaacgacccgcaaaccggcacccttgggcacaccctg
actgagctcgaacgccatggcgtgcagcatagccaggtccgggattttctggccaaaacc
atgattgtcccggtgctgacagcccacccaacggaagtacagcgcaaaagtacgctggat
ctgcaccgacatatcagtcagtgcctggtggacctcgacagccgcctgaccgaagaagaa
agccatcaactggctctggcgctgaccggctatatcaaaacgctctggctgacgcgcatg
ctgcgttttaacaaactgacagtcaatgatgaaattgaaaatgcggtggcctatttcaac
acgaccttcctgaaagcgatccctaccctgtacaccacatttgcacgcaagctgggcggg
ccgcccgacaacgcagcgctgatgcccacctttctgaaaatgggctcatggattggcggt
gaccgcgacggcaaccccaacgtgaacgccgacacgctcacccatgcgatgaaccgccat
gccaccacgctgttcgagtactacctgtcacagattcatctgctgggctccgaactgtcg
ctaagcacctcgctcacgcaggtttcgccggaactggccagcctgtccgacaatagcccg
gatcaatcacgccaccggcttgacgaaccctatcgccgcgcgctgattggcgtatacgcc
cgtctggcagcaacagccaaacacctgactgcgcacgacctggccctgcgtaatacggtg
ccggccgagccgtatgcagacccggcggcgtttgcggcggatctggccgtcattgcccgc
tctctttgcgataaccatgccgcagccgtcgtacccctgcgtttgcaggaactgcagcag
gctgtggccgtgtttggctttcacctggccgcactggatctgcgacaaagctccgatgtg
cacgaacgcattctgaccgaactgtatcagcgcgctgccatcaaatatgacggcaagccg
gtgcaatacgaccagcttgacgaagaacggaaaattgccttgctgctggccgagctggat
gatagccgtcccctggtgtcgccctggcagcaatacagtgaagaaacccgcaaggaactg
gccattttgcaggcggcggctaccgtaaggcgccactacggccaccacgcgatcacccag
tatattgtttctcataccgaaaccctcagtgatctgctggaagtgctggtcctgcaacag
gaaaccgggctgatctcacaacagcgcgatgactcgggccagcgtttgccggtgacacac
ggcgacggcctgatcgttgtaccgctgtttgaaaccattcccgacctggaagccggcccg
gctattatggaccgctggctggccttgccacaagtgcgcgaacgcgtcatccatgctcag
gacaatattcaggaagtcatgctgggttattcggacagtaacaaggatggcggttacctc
acctccaactggtctttatataacgccgaattgcaactgcttgaggtgttccgtcgccat
gacgtgcgcctgcgcctgttccatggccggggcggctcggtcgggcgtggcggcggttcc
agcttcgatgccatcctggcacaaccaccgggcacggtagacggacaaatccggctgacc
gaacagggtgaagtgattcagaccaagtacaaaaatgccgaaagcggacgcgtgaatctg
gaactgcttgtatcagcgacattgctcagcagcctggcgccgcatgaggaaacgcgcaag
gacgcggagaccctgcagcgctatacacaagccatggcctggctgtccgataccgctcag
catgcctatcgtcggctggtatatgacaccccgggctttgttgaatacttttttgcagca
acccccatcaatgaaattgccgggctgaatatcggctcacgtcccgcctcgcgtaaaaag
ggtcagcgtattgaagatctgcgcgccatcccctggggcttctcctgggcgcaatgccgg
ctgatgatcaccggctggtatggtgtgggtaccgcgattgatacgttcattcgcctgggt
accggcaaggacgatggcagtacaccgcaatcacgcacgcaattgttgcgcgacatggct
gcacactggccgtttttccagactgtgctgtccaatatggaaatggtgctggctaaaacc
gatatggacatcggacggcaatacagcgaactggtcgcagaccagcagatacgcagcacg
atcttcggcatgattgaaaaagaattcggcttaacgcgcgatgccctgtttagcatcaaa
cagcaggatctgctggccgacaatcaaccgctgaaagccgcgttgcaggagcgctttgcc
tacaccgatccgttgaattatctgcaggtcgaagtcatccggcgccagcgtgcgctggag
gatgccgaagaagaaccctccaagctggaacaagtacgcagccagcgtaccatccatctg
accatcaatggcattgccaccggtctgcgcaattcaggatag

DBGET integrated database retrieval system