KEGG   Alligator mississippiensis (American alligator): 102561750Help
Entry
102561750         CDS       T03087                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
amj  Alligator mississippiensis (American alligator)
Brite
Enzymes [BR:amj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102561750 (ABHD12)
Peptidases [BR:amj01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   102561750 (ABHD12)
Exosome [BR:amj04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102561750 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 385 aa AA seqDB search
MRKRNESVTVEHERLAAAPPPPPAAGCSLRHSLRLPGGPARDAGMKRPLGRRYGLWFRLR
KLIIWLVGVYIAIPFLVKLCPVIQAKLVFLNFVRAPYFIDLKRPQDQGLNHTCNYYLQPE
EDVTIGVWHTVPAGLWKDAQGKDQPWYEDVLGSNHPIILYLHGNAGTRGGDHRVELYKVL
SFLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPLYIWGHSLGTGVAT
NLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDTITMSGIKFA
NDENVKYISCSLLILHAEDDPVVPFHLGKKLYNLAATSQSFRDYKVQFIPFHTDLGYRHK
YIYRSPELPRILREFLGKSDHGHRH
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacggaacgagtccgtgacggtggagcatgagcgcctcgctgccgccccgcca
ccgcccccggctgccggctgcagcctgaggcacagcctgcgcctgcctggcggccccgcc
cgagacgcgggtatgaagcggccgctcggcaggcgttacggattatggttccgattacgg
aagttaataatctggttggtgggagtgtacatagccattccattcctagtaaaactttgt
cctgttattcaggcaaagctggtcttcttaaattttgtgagagccccatatttcattgac
ttgaaaagaccacaggatcaaggtttaaatcacacctgtaattattatctgcagccagag
gaggatgtaactattggagtctggcacacagtccctgcagggttgtggaaggatgctcaa
ggaaaggaccagccatggtatgaggatgttttgggttccaaccatcctataatcctttac
ttgcatggaaatgcaggaaccagaggaggggatcaccgtgtggaactctacaaggtgtta
agtttccttggttaccatgtagtcacatttgattatcgagggtggggagattcagtaggc
actccttccgagagagggatgacctatgatgccctccatgtgtttgactggataaaggca
agaagtggagacaatcctctctatatatgggggcattccttaggcactggggttgcaacg
aacttagtgagacgcctttgtgaacgagaaactcctccagatgcccttatcctggaatcg
ccatttactaacatacgtgaggaagcaaaaagccatccgttttcagtgatatacagatac
ttccctgggtttgactggttcttcctcgacaccatcacgatgagtggaattaaatttgca
aatgatgagaatgtaaaatacatttcctgttcactgctcatcctccatgctgaagatgac
cctgttgtaccatttcatctcggaaagaagctttacaacttggctgcaacatcacagagc
ttccgggactacaaagtgcagttcattcccttccacacagacctaggctaccggcacaag
tacatctacaggagtccagagctacctcgaatactgcgggaattcctggggaaatctgac
catgggcatcgtcactga

DBGET integrated database retrieval system