KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_06515Help
Entry
AMBLS11_06515     CDS       T02260                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMBLS11_06515
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMBLS11_06515
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMBLS11_06515
Enzymes [BR:amk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AMBLS11_06515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1530921..1531730)
Genome map
AA seq 269 aa AA seqDB search
MDRYAQMFAGLDEKNQGAFVPFVMVGDPDLAQSEAIICQLVESGADALELGIPYSDPIAD
GPTIQASAIRALSNKVTVADCLGVISRVRAKYPDVPIGLLLYSNLVMAQGIENFYNKAQE
AGVDSILIADVPIREAAPFQKAAEATGISQILIAPPNATDETMEKIGEYSKGYTYLLGRA
GVTGAETAANVPASELIERLNKHKAAPALLGFGISTPEQVKSAIDAGAAGAISGSATVNI
IAANLSDSHKMLSELGSFVESMKAATAKG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggatagatatgcacagatgtttgccggccttgatgaaaagaaccaaggcgctttcgta
cctttcgtaatggtaggtgaccccgatttagcgcaatctgaagccattatttgccagcta
gtagaaagcggtgctgacgcacttgagttaggtataccttactctgaccccatcgcagac
ggccccacaatccaagcttctgccattcgcgcgttaagtaataaggtgacggtagcagat
tgcttgggcgttatttcacgtgttcgcgcaaaatatccagacgtgcctatcggcttgcta
ctgtacagcaacttagttatggcccaaggtatagagaacttttacaacaaagcgcaagag
gcaggcgttgactcaattttgattgcagacgtgccaattcgcgaagcggcaccttttcaa
aaagctgcagaagcaacaggcatttctcaaattttgattgcaccgccgaatgctactgac
gaaaccatggaaaaaatcggggaatactcaaaaggctatacatacctgctaggccgtgcg
ggcgttacaggtgcagaaactgccgcaaacgtgcctgcttcagagcttattgagcgcttg
aataaacataaagcagcaccagcattgttaggttttggtatttctacacctgaacaggtt
aaatctgctattgacgcaggtgccgctggcgcaatttcaggctcggcgacggtgaacatc
atcgctgccaatttatcggacagtcacaaaatgctaagcgagctcggcagctttgttgaa
agcatgaaagcagctacggcgaaaggataa

DBGET integrated database retrieval system