KEGG   Ailuropoda melanoleuca (giant panda): 100472263Help
Entry
100472263         CDS       T01329                                 

Gene name
DYRK4
Definition
(RefSeq) dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
  KO
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100472263 (DYRK4)
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100472263 (DYRK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 239 aa AA seqDB search
MAIDMWSLGCIMAELYTGYPLFPGENEVEQLACIMEVLGLPPTHFIQTASRRQTFFDSKG
FPKNMTNNRGKKRYPDSKDLTMVLKTCDTSFLDFLRRCLVWEPSLRMTPDQALKHAWIHE
PRNLKPRSRPQTLRKASLCLPSEARKSKVQGHHHLDIKEVIIKAATIDKIKGGTTKQVQN
SGDQQGSLQHAADVVQLPQLTEASGKPEAVVGTEDSKTSPGKQSKNSSPKNMNILPPIV
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggccattgatatgtggagcctgggctgcatcatggccgagttgtacacaggctaccct
ctgttccccggggagaatgaagtggagcagctggcctgcatcatggaggtgctgggcctg
ccaccaacccacttcattcagacggcctccaggagacagacattctttgattccaaaggt
tttcctaaaaatatgaccaacaacagggggaaaaaaagatacccggattcgaaggatctc
acgatggtgctgaaaacctgcgacaccagcttcctggactttctcagaaggtgtttggta
tgggaaccttctcttcgcatgacccctgaccaggccctcaaacatgcttggattcatgag
ccacggaatctcaaaccacggtccagaccccagaccctgaggaaagccagtctctgtctc
ccctctgaggctcggaagtccaaggttcaggggcatcatcatttggacataaaagaggtg
atcatcaaagcagcgaccatagacaaaataaaaggtggcaccactaaacaggttcagaat
tcaggtgatcagcagggctctctacagcatgcagctgatgttgtccagctgcctcaacta
acagaagcttctggaaagccagaggcagttgttggaacagaagactccaagacctcccca
ggaaaacaaagtaaaaactcctcacccaagaacatgaatattttaccacctattgtatga

DBGET integrated database retrieval system