KEGG   Ailuropoda melanoleuca (giant panda): 100482184Help
Entry
100482184         CDS       T01329                                 

Definition
triosephosphate isomerase-like
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100482184
   01230 Biosynthesis of amino acids
    100482184
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100482184
   00051 Fructose and mannose metabolism
    100482184
   00562 Inositol phosphate metabolism
    100482184
Enzymes [BR:aml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100482184
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100482184
  Exosomal proteins of bladder cancer cells
   100482184
  Exosomal proteins of melanoma cells
   100482184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 264 aa AA seqDB search
LLRGAPDLQCVTASAMAPSRKFFVGGNWKMNGRKKNLGELITTLNAAKVPADTEVVCAPP
TAYIDFARQKLDAKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGE
SDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAY
EPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQP
DVDGFLVGGASLKPEFVDIINAKQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ctactgcgcggtgctcctgaccttcagtgtgttactgctagcgccatggcgccctccagg
aagttcttcgtcgggggcaactggaagatgaatgggcggaagaagaacctgggggagctc
atcaccactctgaacgcggccaaggtgccggccgacaccgaagtggtttgtgcacccccc
accgcctacatcgacttcgcccggcagaagctagatgccaagattgctgtggctgcgcag
aactgctacaaagtgacgaatggggcatttactggggagatcagccctggcatgatcaaa
gactgtggagccacatgggtagtcctggggcactcggaaagaaggcatgtctttggggag
tcagatgagctgattggacagaaggtggcccatgccctggcagagggacttggagtaatt
gcctgcattggagagaaactagatgagagggaagctggcatcactgagaaggttgttttc
gagcaaaccaaggtcatcgcagataacgtgaaggactggagcaaggttgttctggcctat
gagcctgtatgggccattgggactggcaagactgcgacaccccaacaggcccaggaagta
cacgaaaagctccggggatggcttaagtccaacgtctctgacgcggtggctcagagcacc
cgtatcatttatggaggttctgtgactggagcaacctgcaaggagctggcaagccagcct
gatgtggatggcttcctcgtgggcggggcttccctcaagcctgagttcgtggatatcatc
aatgccaaacaataa

DBGET integrated database retrieval system