KEGG   Ailuropoda melanoleuca (giant panda): 100482184Help
Entry
100482184         CDS       T01329                                 

Gene name
TPI1
Definition
(RefSeq) triosephosphate isomerase 1
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100482184 (TPI1)
   01230 Biosynthesis of amino acids
    100482184 (TPI1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100482184 (TPI1)
   00051 Fructose and mannose metabolism
    100482184 (TPI1)
   00562 Inositol phosphate metabolism
    100482184 (TPI1)
Enzymes [BR:aml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100482184 (TPI1)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100482184 (TPI1)
  Exosomal proteins of bladder cancer cells
   100482184 (TPI1)
  Exosomal proteins of melanoma cells
   100482184 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 249 aa AA seqDB search
MAPSRKFFVGGNWKMNGRKKNLGELITTLNAAKVPADTEVVCAPPTAYIDFARQKLDAKI
AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAE
GLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FVDIINAKQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctccaggaagttcttcgtcgggggcaactggaagatgaatgggcggaagaag
aacctgggggagctcatcaccactctgaacgcggccaaggtgccggccgacaccgaagtg
gtttgtgcaccccccaccgcctacatcgacttcgcccggcagaagctagatgccaagatt
gctgtggctgcgcagaactgctacaaagtgacgaatggggcatttactggggagatcagc
cctggcatgatcaaagactgtggagccacatgggtagtcctggggcactcggaaagaagg
catgtctttggggagtcagatgagctgattggacagaaggtggcccatgccctggcagag
ggacttggagtaattgcctgcattggagagaaactagatgagagggaagctggcatcact
gagaaggttgttttcgagcaaaccaaggtcatcgcagataacgtgaaggactggagcaag
gttgttctggcctatgagcctgtatgggccattgggactggcaagactgcgacaccccaa
caggcccaggaagtacacgaaaagctccggggatggcttaagtccaacgtctctgacgcg
gtggctcagagcacccgtatcatttatggaggttctgtgactggagcaacctgcaaggag
ctggcaagccagcctgatgtggatggcttcctcgtgggcggggcttccctcaagcctgag
ttcgtggatatcatcaatgccaaacaataa

DBGET integrated database retrieval system