KEGG   Amycolatopsis mediterranei S699: AMES_3957Help
Entry
AMES_3957         CDS       T02190                                 

Gene name
xynA
Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
amm  Amycolatopsis mediterranei S699
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4383875..4385263
Genome map
AA seq 462 aa AA seqDB search
MAESSSDLRRRRWWRSTTTRVLAGVATLAATATVLVTAPGADAAASTLGAAAAQSGRYFG
TAIAAGRLSNSAYTTIAAREFNMVTPENEMKPDATEPNQNQFNFSAGDQVYNWAISHGSR
VRGHTLAWHGQQPGWMQSMGGSALRSAMINHIQKVMAHYQGKLAYWDVVNEAYNEDGSRR
QSNLQGTGNDWIEVAFRTARAADPSTKLCYNDYNIDNWNYAKTQGVYRMVQDFKSRGVPI
DCVGLQAHFTGGSSVPSSLQTTISSFAALGVDVALTEVDVTNANTSQYSALTQACMNVAR
CVGITVWGVRDSDSWRSSESPLLFDGNGNKKAAYNSVLNALNAAGPGPTTTPTTPTTTPT
DTTTPTTTPTTPGGGSCTATLSAGQSWGDRYNLNVSVSGSSSWTVTMNVPSPERISTTWN
INATWPSSQVLIATPNGSGNNWGVTIMTNGNWTWPGVSCSAS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaagttcgtcggacctgcgccgcaggcgctggtggcggtcgacgaccactcga
gtactggcgggcgtggcgaccttggccgcgaccgcaaccgtgctggtgacggcgcccggc
gcggacgccgcggcgagcacgctgggcgccgcggccgcacagtccggccggtacttcggc
acggcgatcgccgccggtcggctgagcaattcggcctacaccacgatcgcggcgcgcgag
ttcaacatggtgacgcccgaaaacgaaatgaagccggacgcgaccgagccgaaccagaac
cagttcaacttctcggcgggcgaccaggtctacaactgggcgatcagccacggttcccgg
gtccgggggcacaccctcgcctggcacgggcagcaacccggctggatgcagagcatgggc
ggcagtgcgctgcgcagcgcgatgatcaaccacatccagaaggtgatggcccactaccag
ggcaagctcgcctactgggacgtggtcaacgaggcctacaacgaagacggcagccgtcgt
cagtccaacctgcagggcaccggcaacgactggatcgaggtcgccttccggaccgcccgc
gcggccgacccgtcgaccaagctgtgctacaacgactacaacatcgacaactggaactac
gccaagacccaaggcgtctaccgcatggtccaggacttcaagtcccgcggcgtgccgatc
gactgcgtcgggctgcaggcccacttcaccggcggcagctcggtcccgagcagcctgcag
accacgatctccagcttcgcggcgctcggcgtcgacgtggcgctgaccgaggtcgacgtc
acgaacgcgaacacttcgcagtactcggcgctgacccaggcgtgcatgaacgtcgcccgc
tgcgtcggcatcaccgtgtggggtgtgcgggacagcgactcctggcggtccagcgagagc
ccgctgctgttcgacggcaacggcaacaagaaggccgcctacaactcggtgctgaacgcc
ctcaacgccgccggccccggcccgaccacgacaccgacgacacccacgaccaccccgacg
gacaccacgaccccgacgaccacgcccacgacaccgggcgggggcagttgcacggcaacg
ctttcggccgggcagtcctggggtgaccggtacaacctgaacgtctcggtcagcggctcc
tcctcgtggacggtcacgatgaacgtgcccagccccgagcggatcagcaccacctggaac
atcaacgccacctggcccagcagccaggtgctcatcgcgacacccaacggcagcggcaac
aactggggtgtcaccatcatgaccaacgggaactggacctggcccggcgtcagctgcagc
gcctcctga

DBGET integrated database retrieval system