KEGG   Acaryochloris marina: AM1_5892Help
Entry
AM1_5892          CDS       T00617                                 

Definition
chemotaxis response regulator
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
amr  Acaryochloris marina
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:amr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AM1_5892
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AM1_5892
Enzymes [BR:amr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     AM1_5892
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AM1_5892
Two-component system [BR:amr02022]
 CheA family
  CheA-CheYBV
   AM1_5892
Bacterial motility proteins [BR:amr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AM1_5892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5949104..5953612)
Genome map
AA seq 1502 aa AA seqDB search
MNSNDHPSLNADSNTLNTIAPSFYVVAVGASAGGLKPLEVFFENIIPDSGVAFVVIQHLS
PDFKSLMNEILGRRTQMGIQIAEEGMALQPNSIYLIPAGQNMIVRDRCLYLYRQKRDQKP
NFPINLFFQSLADDIQERAIGIVLSGTGSDGTHGLQHIHESGGITLVQDPNTAEFDGMPH
TAISTGCIDYVEAPKVLAQMVNDLGNPAIVPADLVKFSSNLGAEAHQLQKIVELLAKHED
IDFSQYKPSTLGRRVERRRLLTQNNSLNDYASLLTESADERSLLRRDLLINVTQFFRDEK
VWEYLKDKVLRPIIADFPAAETLRIWVTACATGQEAYSMAIIVRELCEELGRQMPIKLFA
TDIDQTALDKAALGSFDESIADYVSVDRLQKYFTYNNGHFTIKRTLREMLIFSPHDLTKN
ASLTRMNVVCCRNVLIYMQPTLQQYVLRNLHFSLNKGGVLLLGTSEDLGELEPEFEVLHS
KNKIFSKFRDQRLNLNYFRTKTIATPVVSGRDPRYRRQADPLTENAFKAHLEELNMTCLL
LDTDEKLLRVCADHLDILRIPEGPATENVRSLLPEVMHLPFISAMSRVLREKQPVQFSSL
LWEHKDGPLDLRFKVSPCQSNCRESMFLRLEISASSRNSPPAQDQAVESSTEVINRIEQL
ELELSYTRENLQATIEELESTNEEQQATNEELIASNEELQSTNEELHAVNEELYTVNNEH
QSKIQELTALSNDIDNLFRSTEIGVVFLDQSLQVRKFTPAANQIFQFLPTDVGRPIRNLA
INVNYPSLIEVLSETARTGKVTEQEINAHGQHLLIRIHPYVDNDNEQQGVVMSIIDITAT
RKVQIELQSQRIKAKLAQDTLEVFQERYQQLYHETPVMMYSLDARGVIIEVSNFWLSKLG
YPRNMTLGATVDIFLNLESQKRFQKLWPRFLESGLSIDIPMQIQTKSGEIIDVLQSMIAE
RDDLGEVSRCLVVSVDISQRKLAEAARLESEQRFRSMADHAPVMIWLTEAPGHCTYLNQE
WLRFTGDSLEQALERGWQDRIHPEDLEESVAAYQQAVTERQPLRLEYRRCDRNGTYCWIL
DTAKPRFLPTGEFAGMIGSCIDISLQKQAEAALELSNLNLEADLAEKDASLHTIEGNLQE
SEARFYSLADNAPVLIWLSDAQGNCTYVNQTWENLTGQSLESQLGDGWLETIHPEDRDRV
KTLFQESCAQQCPFEQEFRQARADGVYRWILATGVPRIAADQFAGLICSCMDISDIKHSQ
KRLEQAIQELQRSNQELEQFAYIASHDLREPLRKIQSFAELLQDDLSTKLDQDQSRYFGY
IMSGAQRMQCLIQDVLQYSRVGRSDQPLELIDLKHVIEIVQSDLSLAIEESQAVIEFDSL
PSIHAHTVEITQVFENLINNAIKFRSSTPPRIQISAEQQPESWTILVKDNGIGIPEDSLE
RVFVMFQRLHYSNQYPGTGIGLALCRKVIESYGGTLTCTSAPGKGATFILQFPLQPVVPI
LQ
NT seq 4509 nt NT seq  +upstreamnt  +downstreamnt
atgaattctaacgatcacccatccctaaatgctgattcaaatacgctaaacactattgct
ccttcattctatgtcgttgccgttggagcatccgcaggtggcctgaagcctcttgaagtt
ttctttgaaaatataattcctgactcgggggtggcttttgttgttattcaacatttgtcc
ccagattttaagagtttaatgaatgaaattttgggccgtcgtacccaaatgggcattcag
attgcagaagaagggatggcacttcagcccaattcaatctatttgatcccggcaggtcaa
aatatgattgttcgggaccgttgcctttacctctatcgccagaagcgagaccaaaagccg
aactttcctattaatttattttttcagtccttggcagatgatattcaagaacgtgctatt
ggtattgttctctctggtacagggagcgacggtacccatgggctccaacatatccatgaa
agtggggggattacgttagttcaagaccccaatacggctgaattcgatggtatgccccat
accgctatcagtactggatgtattgattatgtagaagctccaaaagttctggcgcaaatg
gtgaacgatttaggaaatcctgccatcgttccagcagatttagtgaaatttagcagcaac
ttaggtgcagaagcccatcaactccaaaaaattgtagagttgctagccaagcatgaagat
atcgatttttcccaatataaaccatccactctgggccgccgagtcgaacgccgccgactc
ttaacccaaaacaattcactgaacgactatgccagcctcttaaccgaatctgccgatgaa
cgttccctactacgccgggatttactgattaatgtcacccaattctttcgagatgagaag
gtttgggaatacctaaaagataaggttttgcgtcctatcattgcagattttcccgcagca
gaaaccttaaggatatgggtaaccgcctgcgcgacaggtcaggaagcttattccatggcg
attattgttcgagagctgtgcgaggaactgggacgacagatgcccattaagctctttgca
acagacatcgatcagactgctctagacaaagctgcattagggagctttgatgagtctatt
gcggattatgtgagtgtagaccggctgcagaaatatttcacctacaataacggtcacttc
acgattaaacgaaccttgcgagaaatgctgattttctcgccccatgatttaaccaaaaat
gccagtctgacccgcatgaatgtcgtgtgctgtcggaatgtgctgatctatatgcagcct
actttgcagcagtatgtactgcgcaatctgcatttttccctaaataagggcggagttcta
ttattgggaacctctgaagacctaggtgaactagagcctgaatttgaggttttacattct
aaaaataagatattttcgaaattcagggatcaacgcctgaatctaaactattttcgaact
aaaacgattgctacaccagtcgtgtcggggcgagatcctcgctaccgccgtcaagctgac
cctctgactgagaatgcgtttaaagcccatcttgaagaactgaacatgacttgtctgttg
ctggatacggacgagaagttacttcgggtttgtgccgatcacctggatattttacgtatc
ccagaggggccagccactgaaaatgtcagatccttgctccccgaggtgatgcatttgccc
tttatctcggcgatgagtcgagtccttcgagaaaagcagccagtacagtttagcagcctc
ttgtgggagcacaaggatggaccgcttgacttaaggttcaaggttagcccctgccaatcc
aattgccgagaatcgatgttcttgagacttgagatctccgctagctcccgcaattctccc
cctgcacaagatcaggctgtagaaagtagtacggaggtgatcaaccggattgagcagctg
gagttggaactgtcttatactcgcgaaaatctacaggccaccattgaggagttagaaagt
accaatgaagagcagcaggctactaacgaggaactgattgcctctaatgaagagctgcag
agtaccaatgaagaactacatgccgtcaacgaagaactgtacaccgttaataatgaacat
caatctaaaattcaggaattgacagctctgagtaatgacattgataacctgttccgcagc
acagaaattggcgtggtgtttctagaccagagtttgcaagtgcggaaatttacccccgct
gcgaatcaaatttttcaatttctacccacggatgtggggcgtccgattcgaaatttagcc
atcaatgtcaactatccctcgttgattgaagtcctctcggaaacagcccgcactggcaaa
gtcaccgagcaggaaattaacgcccatggacaacacttgctgattcggatccatccctat
gtggataacgataatgagcaacagggagtggtgatgtcaattattgatattacggccact
cgcaaggtccagattgaactccaatctcagcgcattaaagccaagctagcccaggatacc
ctagaggtttttcaagagcgctatcagcagctctaccatgaaaccccggtgatgatgtac
tccttggatgctcgaggagtgattatagaagtcagtaatttctggctctccaaattaggg
tatccccgcaatatgacgttgggggcaaccgtcgatatatttctcaacctagagtcccaa
aagcggtttcaaaagctatggccgcgttttctagagtctggtttgagcattgatataccg
atgcagatacagaccaaatcaggtgagatcattgatgtgttgcaatcaatgattgccgag
cgtgatgatctaggagaagtgtctcgatgcttagtggtttcggtcgatattagccaacgc
aaattggcagaagctgcgagactagagagcgaacagcgatttcgctccatggcggaccat
gcacctgtgatgatctggctcacggaagctccaggacattgcacttatctgaatcaagag
tggctgaggtttaccggggattctctagaacaagcgttagaacgaggttggcaagataga
attcacccggaggatttagaggaaagtgtggcggcttaccaacaggccgttaccgaacgc
cagcccttgcgtttagagtatcgacgatgcgatcgcaacggcacctattgttggatctta
gataccgccaagcctcgatttctacccacaggggaatttgccggcatgattgggtcttgt
attgatatcagcctacagaaacaagccgaagcagctttagaattatccaacctcaatctg
gaagctgatttagctgaaaaagatgcctctttacataccattgaaggtaatttacaagaa
agtgaggctcgattttactccctagcagacaatgctccagttttaatctggctcagtgat
gctcaagggaactgtacctatgtcaatcaaacctgggagaatttgaccggccaatctttg
gagtcccaactgggtgacggatggctagagaccattcatccagaggatcgtgatcgagta
aaaaccttattccaagagagctgtgctcaacaatgtccctttgagcaggaatttcgacaa
gccagagcagatggcgtctatcgttggattttggcaacgggagtccctaggatagcagcc
gatcagtttgctggtttgatttgttcctgtatggatatttccgatatcaagcattctcaa
aagagattagagcaagcgattcaagagctacaacgatcgaatcaggagctagagcagttt
gcctatatcgcttcccacgatttacgggaaccgctccgtaaaatccaaagttttgccgag
ctgttacaagacgatttatcgacaaagctggatcaagatcaaagccgatactttgggtac
atcatgtcaggggcacagcggatgcaatgtctcattcaagatgtgctgcaatactctcgg
gttggacgaagcgaccaacccctagagttgatcgatttgaaacacgtgatcgaaattgtg
caatccgatttaagtttagcgatagaagaaagtcaggctgttattgaatttgactcactc
ccctctattcatgcccataccgtagagattactcaagtttttgaaaatctaatcaataat
gccatcaagtttcgctcttctactccaccgcggattcagatctctgcagaacaacaacct
gaatcttggacaatcttggttaaggataatggaattggaattcctgaagactctttggag
cgtgtttttgtcatgtttcaacgcttgcattattccaatcaatacccagggacaggaatt
ggattggcattatgtcgcaaagttatcgaaagctatgggggaaccctgacgtgcacatcc
gccccaggtaaaggggcaacctttatcctccaattccccttgcagcctgtggtgccgata
ttgcaatag

DBGET integrated database retrieval system