KEGG   Alkaliphilus metalliredigens: Amet_0722Help
Entry
Amet_0722         CDS       T00551                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:amt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Amet_0722
Enzymes [BR:amt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Amet_0722
DNA repair and recombination proteins [BR:amt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Amet_0722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 AAA_11 Viral_helicase1 HHH_5 PIF1 T2SSE HHH_2 Helicase_RecD AAA_22 RsgA_GTPase HHH AAA PhoH AAA_28 AAA_24 TrwB_AAD_bind DUF853 DEAD UvrD-helicase SRP54 ATPase_2 FtsK_SpoIIIE UvrD_C NTPase_1 AAA_29 DUF2075
Motif
Other DBs
NCBI-ProteinID: ABR46947
JGI: Amet0722
UniProt: A6TL79
Position
769231..771495
Genome map
AA seq 754 aa AA seqDB search
MRVTGGSAVVELEGQLVEIIFQNESNGYMVGILEAKEEIATIVGCLPAIKEGEQLAVKGK
WAVHPVYGRQLEVGEYRPIQPSTKEGILNYLSSGVIKGVGKKMAERIVDLFGMDSLEVIQ
YAPERLREVEGIGRAKAETITETFRDQKELREIILFLSEYHITPNYAVKIHKKYGDKTIA
TIQENPYRLADEIVGIGFKRADAIARNMGVHPHSKYRIHSGIKYMLNTFQGEGHTYAPGV
KLIQRAEELLRVEEGQVEGAIQELALNQEIQLERIDDEIIVYSMPYYYAESNVCKKLISL
AQVELDPIEMDIDEELQKIEQAEEMTLAKQQKEAIKEAIENGISVITGGPGTGKTTTINS
LIKVFEKLELKMLLAAPTGRASKRMTEATGKESKTIHRLLELGFGDDREGMLFQRNEDNP
LDCHVIIIDEVSMVDIILMNSLMKSIARGTRVVLVGDVDQLPSVGAGNVLRDIIDSKVVK
TIRLTEIFRQAQESMIVVNAHRINQGLYPQLNEKQKDFYFMKRNAKEDVLATVVELVRDR
LPKHYQFDALRDIQVLTPMKKGETGTLNLNKELQAALNPPNVSKAEKDLKEKIFREGDKV
MQIKNNYTLKWRCLDPMAEEQKGEGVFNGDIGYVQSIDTEAEELVILFDDQKQVNYSFTQ
LDELELAYSVTIHKSQGSEFPVVVIPITWGPPMLLTRNLLYTAVTRARSLVVLVGVESYL
KKMVDNNKIIERYSGLGRRLGKYFEMQIKDETKI
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtaacaggaggaagtgctgtggttgagctagaaggacagttagtggaaatcatt
tttcaaaatgaatccaatggatatatggtagggattttagaggcaaaagaagagatcgcc
acaattgtaggctgtttgcctgccattaaagaaggagaacaattggctgtaaaggggaaa
tgggcggtgcatcctgtctacggcagacagctagaggtaggggaataccgtcccattcaa
ccctccacaaaggaagggatcttaaattacttatcctcaggagtcatcaaaggcgtggga
aaaaagatggcggagcgaattgtggatctatttggaatggattctttggaggtgattcaa
tatgccccagaacgattgagggaggtagagggtattgggcgagctaaggcggagaccatc
accgagacctttagggatcaaaaggagctcagggaaatcattctctttctttcggagtat
catatcacccctaattatgcagtaaagatacataaaaagtatggagataaaaccatcgcc
actattcaagaaaatccctatcggttggcggatgaaattgttgggattggttttaaaaga
gccgatgccatagctcgaaatatgggggttcatccccattcaaaataccgaattcattca
ggaattaaatatatgttaaacacattccaaggggaaggtcatacctatgcaccgggtgtt
aagctaatccaacgggcagaggagctactcagggtagaagaaggtcaggtagaaggcgcc
atccaagagcttgccctgaatcaggaaatacaattagaacgaattgatgatgagattatc
gtttattctatgccctattattatgcagagtctaatgtatgtaaaaagctcatcagttta
gctcaagtagagttagaccccatcgaaatggatattgacgaagaactacagaagattgaa
caagcagaagagatgacactggcaaagcaacaaaaagaagccatcaaagaagcaatcgag
aatggaatttcagtcattactggaggtccgggaacaggaaagacaacaaccatcaatagt
ctgattaaggttttcgaaaagttagagttaaagatgctattggcagcccccacaggcaga
gcctctaaaagaatgacagaggccactggaaaagaatcaaaaaccattcaccggttattg
gaattgggatttggagatgaccgtgaaggcatgctttttcaacgaaatgaagataatccc
ctagattgtcatgtcatcatcattgatgaagtgtccatggtggatattatattaatgaat
agcctaatgaagtccattgctagggggactcgggttgtattagtaggagatgtagatcag
cttccctctgtgggtgctggaaatgtacttcgagacattattgacagcaaggttgtgaag
accattcgactaacggaaattttccgtcaagcccaggagagcatgattgtcgtcaatgcc
catcgaatcaaccaggggctctatccacaattaaatgaaaagcaaaaggatttttatttt
atgaaacgaaatgccaaggaggatgttttagccaccgtagtggaattggtgagagaccga
cttcctaagcactatcagtttgacgccctacgtgatattcaagtgctgacacccatgaaa
aagggggagactggaacactaaatctgaacaaagagcttcaggcagctttgaatcctcca
aatgtatccaaggcagagaaggatctcaaggaaaagatcttccgagagggagacaaggta
atgcaaattaaaaataactatacattaaagtggcgctgtctagatcccatggctgaagaa
caaaagggggagggtgtcttcaatggagatattggatatgtccaaagcatcgatacagag
gcggaagagttggtcatactatttgatgaccaaaaacaagtcaactacagctttacccag
ctagatgaattggaactggcctactccgtcaccatccacaaaagtcaaggaagtgagttt
cccgttgtagtcattcccattacatggggaccccctatgttattaactcgaaatctactc
tacaccgcagtaacccgagccagatccctggtggtattggtcggggtggaaagctattta
aaaaaaatggtggacaacaataaaattattgagcggtactctggactagggagacgtttg
gggaaatactttgaaatgcagattaaggatgaaactaaaatttga

DBGET integrated database retrieval system