KEGG   Acidiphilium multivorum: ACMV_12250Help
Entry
ACMV_12250        CDS       T01446                                 

Definition
(GenBank) putative cytochrome c
  KO
K08738  cytochrome c
Organism
amv  Acidiphilium multivorum
Pathway
amv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amv00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ACMV_12250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Haem_bd
Motif
Other DBs
NCBI-ProteinID: BAJ80572
NITE: ACMV_12250
UniProt: F0IXR2
Position
complement(1377383..1378807)
Genome map
AA seq 474 aa AA seqDB search
MSDQNHPSSGHGGKGRDPLLLNKIAGGILSAGLLVWIAIHIAGVMTGEKEVKKPVIKTAE
APVAAKTSGIPSIDGLIVKADVKKGEAFVQQQCAACHTLNKGGAAGVGPNLYGVMGEPMF
KKAGYTFSGAVTKAASGVWTYQKMNEWLDDPQKFAPGTRMGYTGIKNDNVRADAIAYLRT
LSDNPIPLPKPGAGGSAVASKGAAPAGLDSGAPVITTLYASADASKGEAFFQQQCSACHT
VTKGGANGVGPNLYGVVGAPMFAKAGYTFSGAAKKHADGKWTPHELDEWLYAPTKAVPGT
HMAYPGIKNNQTRADVIAYLNKQSDHPVNLAAAAGPAATTATAAGAAPTGLDSSAPSVKT
LLASAAPAKGQAMFQQQCSACHSINKGGANGVGPNLYGVVGAKMFAAAGYSFSSAAKKHA
TGDWTAHELNEWLYDPMKAVPGTHMAYPGIKNNVARANMIAYLNQQSDHPETFK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatcagaaccacccgtcttccggacacggcggcaagggccgcgacccgctgctg
ctgaacaagattgccggtggcattctctcggccgggctcctggtctggatcgcgatccat
atcgctggcgtgatgaccggcgagaaggaggtcaagaagccggtcatcaagaccgccgag
gcgcccgtcgcggccaagaccagcggcattccctccatcgacgggctgatcgtcaaggcc
gacgtgaagaagggcgaggccttcgtgcagcagcaatgcgcggcctgccacacgctgaac
aagggcggcgcggccggcgtggggccgaatctctacggcgtcatgggcgagccgatgttc
aagaaggccggctataccttctccggcgcggtgacgaaggccgcctccggcgtgtggacc
taccagaagatgaacgagtggctggatgacccgcagaaattcgcgccgggcacccgcatg
ggctacacgggcatcaagaacgacaatgtccgcgccgacgcgatcgcctatctgcgcacc
ctctcggacaacccgatcccgctgcccaagccgggcgccggcggttcggccgtcgcctcg
aagggggcggcgccagcgggcctcgattcgggcgcgccggtgatcaccacgctttatgcc
agcgccgatgccagcaagggcgaggccttcttccagcagcaatgctcggcctgccacacg
gtcaccaagggcggggcgaacggcgtcgggccgaacctttacggtgtcgtcggcgcgccg
atgttcgccaaggccggctacaccttctccggcgcggcgaagaagcatgccgacggcaag
tggacgccgcacgagctcgacgaatggctctacgcgccgacgaaggcggtgccgggcacg
cacatggcctatccgggcatcaagaacaaccagacccgggcggatgtgatcgcctatctc
aacaagcagtccgaccatccggtgaacctcgccgccgctgcgggccccgccgcgacgacg
gcgacggccgccggtgcggcgccgaccgggctcgattccagcgcgccttcggtcaagacg
ctgctggccagcgccgcgccggccaagggccaggcgatgttccagcagcagtgctcggcc
tgccattcgatcaacaagggcggtgccaacggcgtcggccccaatctctacggcgtggtc
ggcgcgaaaatgttcgcggcggcgggctacagcttctcctcggccgcgaagaagcatgcg
accggcgactggaccgcgcatgagctgaacgagtggctctacgatccgatgaaggcggtg
ccgggcacgcacatggcctatccgggcatcaagaacaacgtcgcccgcgccaacatgatc
gcctatctcaaccagcagtccgaccatcccgaaaccttcaaatga

DBGET integrated database retrieval system