KEGG   Acidiphilium multivorum: ACMV_25390Help
Entry
ACMV_25390        CDS       T01446                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
amv  Acidiphilium multivorum
Pathway
amv00010  Glycolysis / Gluconeogenesis
amv00620  Pyruvate metabolism
amv00640  Propanoate metabolism
amv00680  Methane metabolism
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
amv01120  Microbial metabolism in diverse environments
amv01130  Biosynthesis of antibiotics
amv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACMV_25390 (acsA)
   00620 Pyruvate metabolism
    ACMV_25390 (acsA)
   00640 Propanoate metabolism
    ACMV_25390 (acsA)
  Energy metabolism
   00680 Methane metabolism
    ACMV_25390 (acsA)
Enzymes [BR:amv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ACMV_25390 (acsA)
Lipid biosynthesis proteins [BR:amv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ACMV_25390 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: BAJ81886
NITE: ACMV_25390
UniProt: F0J2E2
Position
complement(2798856..2800790)
Genome map
AA seq 644 aa AA seqDB search
MSQPETIPVKPEIAANALVDRARYGDMARRAAENPEAFWAEESKRITWMTPPTRIKNVTF
TGNVSIKWFEDGVLNASANCLDRHLATRGDQVAIIWEGDDPGEQKHVTYRELHAEVCRMA
NVLKSLGVRKGDRVTVYMPMIVEAAVAILACARIGAVHSVVFGGFSPDSLANRIQDCDSS
VLITADEGRRGGRKVPLKANVDAAAKSCPMLKKVVVVKATGGQVDMQDGRDVWYHEAAAT
MPLDCPPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYMVWASFTHQYVFDYHDGEVYWC
TADVGWVTGHTYIVYGPLANGATTLMFEGIPNYPDTSRFWQVVDKHKVNIFYTAPTAIRA
LMRDGEGPVKKTSRASLRVLGSVGEPINPEAWLWYYRVVGDQRCPIVDTWWQTETGGILI
SALPGAIDQKPGSATLPLPGVKPVLVDGDGNVLEGATEGNLCLADSWPGQMRTVYGDHER
FIQTYFSTFRGFYFSGDGARRDEDGYYWITGRVDDVINVSGHRMGTAEVESALVAHAKVA
EAAVVGFPHDIKGQGIYAYVTLVAGEEPTEELRKELVMWVRKEIGPIAAPDAIQWAPGLP
KTRSGKIMRRILRKIAANETDSLGDTSTLADPAVVDDLVRNRMA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagcccgaaaccattcccgtgaagccggagatcgccgctaacgcgcttgtcgat
cgtgcgagatacggcgacatggcgcgccgcgcggcggaaaatcccgaggcgttctgggcc
gaggaatccaagcgcatcacctggatgacgccgccgacccgcatcaagaacgtcaccttc
accggcaatgtctcgatcaagtggttcgaggacggcgtgctgaacgcatcggccaactgt
ctcgaccggcatctcgccacccgcggcgaccaggttgcgatcatctgggaaggtgacgat
cccggcgaacagaagcatgtgacctatcgcgagttgcacgccgaagtgtgccgcatggcg
aatgtgctgaagtcgctcggcgtgcggaagggcgaccgcgtcaccgtctacatgccgatg
atcgtcgaggcggcggtggcgatcctcgcctgcgcgcgcatcggcgcggttcattccgtg
gtgttcggcgggttctcgccggacagcctcgccaaccgcatccaggattgcgacagctcg
gtcctgatcaccgccgatgaaggccgtcgcggcggccgcaaggtgccgctgaaggccaat
gtcgatgccgcggcgaaatcctgcccgatgctgaagaaggttgtcgtggtgaaggcgacc
ggcggccaggtcgacatgcaggacggccgcgacgtctggtatcacgaggcggcggcgacc
atgccgctcgactgcccccccgagccgatgaatgccgaggacccgctcttcatcctctac
acctccggctccaccggcaagcccaagggcgtgctgcacacgaccggtggttacatggtc
tgggcgagcttcacccaccagtatgtgttcgattaccatgacggcgaggtctactggtgc
accgccgatgtcggctgggtgaccggccatacctatatcgtctatggtccgctcgccaac
ggcgccaccacgctgatgttcgaggggattccgaactaccccgacaccagccgcttctgg
caggtggtggacaagcacaaggtcaacatcttctacaccgccccgaccgcgatccgcgcg
ctgatgcgcgacggcgaggggccggtgaaaaagacctcgcgcgcctcgctgcgggtgctg
ggttcggtcggcgagccgatcaatcccgaagcctggctctggtactatcgcgtcgtcggc
gaccagcgctgcccgatcgtcgatacctggtggcagaccgaaaccggcggcatcctgatc
tcggcgctgcccggcgcgatcgaccagaagccaggctcggcgacgctgccgctgcccggc
gtgaagccggttctggtcgatggcgacggcaacgtcctggaaggggcgactgaaggcaat
ctctgcctcgccgacagctggcccggccagatgcggacggtttacggcgatcacgagcgg
ttcatccagacctatttctcgaccttccggggcttctacttctccggcgacggcgcccgc
cgcgacgaggatggatattactggatcaccggccgggtggacgacgtcataaacgtctcc
ggccaccggatgggcacggccgaggtcgagagcgcgctggtcgcgcacgccaaggtggcc
gaggccgcggtggtgggcttcccgcacgacatcaagggacagggcatctacgcctatgtg
acgctcgtcgccggcgaggagccgaccgaggaactgcgcaaggaactggtgatgtgggtc
cgcaaggaaatcggcccgatcgccgcgccggatgcgatccagtgggcgcccggcctgccc
aagacgcgctcgggcaagatcatgcgccgaatcctgcgcaagatcgccgcgaacgagacc
gacagcctgggtgatacctcgaccctcgccgacccggcggtggtcgacgatcttgtccgc
aaccggatggcctga

DBGET integrated database retrieval system