KEGG   Nostoc sp. PCC 7120: alr4976Help
Entry
alr4976           CDS       T00069                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    alr4976
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    alr4976
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    alr4976
Enzymes [BR:ana01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     alr4976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5939982..5941556
Genome map
AA seq 524 aa AA seqDB search
MNMQLINRNFLATHCKRRNFLLGAGLITGLVVASQWHPVMAQTTFSGYPFSLGVASGDPL
PDSVVLWTRLAPDPVNGGGMSRVNVPVQWQIARDENMTQVVQKGTVLATPELAHSVHVDV
RGLEPDRWYWYQFKVGNEVSPKGRTRTAAAPHSSIQKFNFAFASCQDWQNGFYTAYKHMA
DEDLDLVVHLGDYIYEYGPRSGAPRQHIGPEIVTLSDYRNRYALYRTDVNLQAAHANFPW
IFTWDDHEVDNNYANFIPEDNQSRQAFEGRRANAYQAYYEHMPLRLSSLPKQSSMLLYRR
LTFGDLAEFNVLDTRQYRTDQPCNDGLKPRCDAALDSKATMTGARQEGWLLRGLDQSKAR
WNVIAQQTMLGQFDFDARPDSQVFNVDQWDGYVAARNRLLSFLAQRKPSNPVVITGDIHS
SWVHDLKTDFNNPLSATVGTEFVGTSITSNFPTNSIAPVKAALSNNPHTKFFDAAYRGYV
RCQLTRERWQTDYRVVSSILEENASISTLASFVVENGQPGAKTA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatgcaattaataaatcgcaacttcctcgcaacccattgtaaacgcaggaatttt
ttactgggtgcaggattaatcacagggttagtagtagccagccaatggcatcctgtgatg
gcgcaaacaacattttctggctatccatttagtctaggtgttgcatctggagatccctta
cctgatagcgtggtgttatggacaagactagcaccagatccagtaaatgggggtggtatg
tcacgggtcaatgttcctgtgcagtggcaaatcgcacgggatgaaaatatgacacaagtt
gtacaaaaaggaacagttttagcaacaccagaattagctcactcagtacacgttgatgtg
cgtgggctagagcctgatcgttggtactggtatcaattcaaagtgggtaatgaagtcagc
cctaaaggacgcacacgtacagccgcagcacctcatagctctattcaaaaatttaatttt
gcctttgcttcttgtcaagattggcagaatggcttttacacagcctataagcacatggct
gacgaagaccttgacttagtagtgcatctgggtgactacatctatgagtatgggcctcgt
tctggtgcgccacgtcagcatattggcccagaaatcgttacccttagcgattaccgcaac
cgctatgccttgtatagaaccgacgtaaatttacaagcagctcatgctaacttcccgtgg
atttttacttgggatgaccatgaagtagataacaactatgccaacttcatacctgaagat
aaccagagtcggcaagcattcgaaggccgacgagccaatgcttaccaagcttactatgag
catatgccattgcgcctatcttctttgccgaagcagtctagtatgctgctatatcgacga
ttaacttttggggatttagccgagttcaatgtcttagatactcgccaataccggactgac
caaccttgtaatgatggactcaagccacgttgtgatgcagctttagattcaaaagcgact
atgacaggtgcaagacaagaaggttggttactcagaggactagaccaatcaaaagcgcgt
tggaatgtaattgctcaacaaacaatgcttggtcaatttgatttcgatgctcgtccagat
tcccaagtcttcaatgttgaccagtgggatggttatgtagctgctcgtaatcggctcttg
agctttttagcacagcgcaaaccttctaacccagtagttattactggagatatccattcc
agttgggtacatgatttaaaaactgacttcaataatccactgtcagcaaccgttgggact
gagtttgtgggtacttccattacttctaacttccctacaaattccatcgcaccagttaaa
gcggctctgagtaacaacccccatacaaaattcttcgatgctgcttatcgcggttatgtt
cgttgccaactaactagagaacgttggcaaactgattatcgtgttgtgtctagcatcctt
gaagagaatgcttctattagcaccctcgcttcctttgtagtagaaaacgggcaaccaggc
gcaaaaacagcgtga

DBGET integrated database retrieval system