KEGG   Bradyrhizobium oligotrophicum: S58_70810Help
Entry
S58_70810         CDS       T02484                                 

Definition
(GenBank) acetyl-CoA acetyltransferase with thiolase domain
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00071  Fatty acid degradation
aol00072  Synthesis and degradation of ketone bodies
aol00280  Valine, leucine and isoleucine degradation
aol00310  Lysine degradation
aol00362  Benzoate degradation
aol00380  Tryptophan metabolism
aol00620  Pyruvate metabolism
aol00630  Glyoxylate and dicarboxylate metabolism
aol00640  Propanoate metabolism
aol00650  Butanoate metabolism
aol00900  Terpenoid backbone biosynthesis
aol01100  Metabolic pathways
aol01110  Biosynthesis of secondary metabolites
aol01120  Microbial metabolism in diverse environments
aol01130  Biosynthesis of antibiotics
aol01200  Carbon metabolism
aol01212  Fatty acid metabolism
aol02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aol00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    S58_70810
   00630 Glyoxylate and dicarboxylate metabolism
    S58_70810
   00640 Propanoate metabolism
    S58_70810
   00650 Butanoate metabolism
    S58_70810
  Lipid metabolism
   00071 Fatty acid degradation
    S58_70810
   00072 Synthesis and degradation of ketone bodies
    S58_70810
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    S58_70810
   00310 Lysine degradation
    S58_70810
   00380 Tryptophan metabolism
    S58_70810
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    S58_70810
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    S58_70810
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    S58_70810
Enzymes [BR:aol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     S58_70810
Exosome [BR:aol04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   S58_70810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt YadA_head
Motif
Other DBs
NCBI-ProteinID: BAM93046
UniProt: M4ZHF8
Position
complement(8032776..8033954)
Genome map
AA seq 392 aa AA seqDB search
MSDDVVIVSAARTAVGSFNGAFASVPAHELGAVAIKAALERAGVEPGRVSEVIMGQILTA
AQGQNPARQASIGAGIPVESPAWGINQLCGSGLRSVALGYQALVNGDSDIVVAGGQESMS
MAAHAQYLRAGVKMGSLDLVDTMIKDGLWDAFNGYHMGNTAENVAKQYQITRAQQDEFAV
ASQNKAEAAQKAGRFKDEIAPVTIKGRKGDTVVDTDEYPRHGATIEAMAKLRAAFEKDGT
VTAGNASGINDGAAAVVLMTAKQAAKEGKTPLARIVSWGQAGVDPKIMGTGPIPASRTAL
KKAGWNIADLDLIEANEAFAAQACAVNKDLGWDTAKVNVNGGAIAIGHPIGASGARVLVT
LLHEMQKRDAKKGLATLCIGGGMGIALCVARD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgatgtcgtcatcgtcagcgctgcccgcaccgcggttggaagcttcaacggt
gcctttgccagtgttccagcccacgagctgggcgctgtcgccatcaaggccgcgctggag
cgcgccggggtcgagcccggccgtgtgtccgaggtcatcatgggccagatcctgaccgct
gcgcagggccagaacccggcgcgccaggcctccatcggggccggcattccggtcgagagc
ccggcctggggcatcaaccagctgtgcggctccggtctgcgctccgtcgcgctgggctat
caggcgctcgtcaatggtgactccgacatcgtggtcgccggcggccaggagtcgatgagc
atggcggcgcatgcgcagtacctgcgcgccggcgtcaagatgggctcgctcgacctggtc
gacacgatgatcaaggacggcctgtgggatgccttcaacggctatcacatgggcaacacc
gccgagaacgtcgccaagcaatatcagatcacgcgggcgcagcaggacgagttcgccgtt
gcatcgcagaacaaggccgaggcggcgcagaaggccggcaggttcaaggacgagatcgcc
cccgtgaccatcaagggccgcaagggcgacaccgtggtcgacaccgacgaatatccgcgt
cacggcgccacgatcgaggcgatggccaagctccgcgcggcgttcgagaaggacggcacc
gtcaccgccggcaacgcctctggcatcaatgacggcgccgctgccgtggtgctgatgacc
gccaagcaggcggccaaggaaggcaagacgccgctggcgcggatcgtgtcctggggccag
gccggcgtcgatccgaagatcatgggcaccggcccgatcccggcgtcgcgcaccgcgctg
aagaaggccggctggaatattgccgacctcgatctgatcgaggccaacgaggcgttcgcg
gcgcaggcttgcgccgtcaacaaggatctcggctgggatacagcgaaggtcaacgtcaat
ggcggcgcgatcgcgatcggccatccgatcggagcctccggtgcgcgtgtgctcgtgact
ctgctgcacgagatgcagaagcgcgacgccaagaagggtctcgccacgctgtgcattggc
ggcggcatgggcatcgcactgtgcgtcgcacgcgactaa

DBGET integrated database retrieval system