KEGG   Acyrthosiphon pisum (pea aphid): 100159612Help
Entry
100159612         CDS       T01076                                 

Definition
tropomyosin-1
Organism
api  Acyrthosiphon pisum (pea aphid)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKMEKDSAMDKADTCEGQSKDANLRADKVNEDVRDCQKKLTQVESDLDTN
KNKLEEAIKQLEDREKALTAAESEVAALNRKVQMIEEDLERSEERSQAAASKLAEASQAA
DESQRMCKVLENRSQQDEERMDQLTNQLKEARLLAEDADGKSDEVSRKLAFVEDELEVAE
DRVKSGDSKIMELEEELKVVGNSLKSLEVSEEKANQRVEEYKHQIKQLTVKLKEAEARAE
FAEKTVKKLQKEVDRLEDELGLNKDRYKSLADEMDSTFAELAGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccattaagaagaagatgcaggccatgaagatggagaaggatagcgccatggac
aaggccgacacttgtgaaggccagtccaaggatgcgaaccttcgtgcagacaaagttaat
gaagatgtgagagattgtcaaaagaaattgacccaggtagaaagtgatctggacacaaac
aagaataagttggaagaggccatcaaacagttagaggacagagaaaaggcacttactgcg
gctgaaagtgaagtagctgctttgaacaggaaagtccagatgattgaagaagaccttgaa
agatcagaagaaaggtctcaagctgctgcatcgaaattggctgaggcttctcaagcagct
gatgaatctcaacgtatgtgcaaagtactcgaaaaccgtagccagcaagacgaggaacgt
atggaccaattgactaaccaattaaaggaagctcgtctcttagctgaagatgctgacgga
aaatctgatgaagtttcgaggaaacttgcttttgttgaagatgaacttgaagtagcagag
gatcgtgtgaaatctggagactcgaaaatcatggagctggaagaagaattgaaagttgtc
ggaaacagcttgaagtcattggaagtttctgaagaaaaggccaatcaacgagtggaagag
tacaagcatcaaatcaaacaactcactgtaaaattaaaggaggctgaagctcgtgctgaa
ttcgccgagaagaccgttaagaaactgcagaaggaagttgacagacttgaagatgaactc
ggcctcaacaaagacagatacaagtctttggctgacgagatggactccacatttgctgaa
ttggctggatattaa

DBGET integrated database retrieval system