KEGG   Acyrthosiphon pisum (pea aphid): 100162303Help
Entry
100162303         CDS       T01076                                 

Definition
(RefSeq) phosphoglycerate mutase 1-like
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00010  Glycolysis / Gluconeogenesis
api00260  Glycine, serine and threonine metabolism
api01100  Metabolic pathways
api01200  Carbon metabolism
api01230  Biosynthesis of amino acids
Module
api_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
api_M00002  Glycolysis, core module involving three-carbon compounds
api_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100162303
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100162303
Enzymes [BR:api01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100162303
Membrane trafficking [BR:api04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100162303
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100162303
  Exosomal proteins of melanoma cells
   100162303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 100162303
NCBI-ProteinID: XP_001946765
APHIDBASE: ACYPI003463
UniProt: J9JT11
Position
Un
AA seq 294 aa AA seqDB search
MYTSFTKQFVKTIEQSRIWCTTSKNISHKNNCDIAKGSTCKTYKIVMIRHGESDWNKKNL
FCGWYDASLSSKGVEEAISAGKTLKQRCYEFDVAHTSVLKRAEDTLCNILNLVDPKNSCT
VHKNWRLNERHYGSLTGLNKSETAKKYGEDKVKLWRRSFDIPPPPMEVDHPYYCHIKNDP
RYVDGPSECEFPTHESLKMTIQRTLPYWDNVIVPQIKNGCRIIIAAHGNSLRGIIKHLDN
ITDEGIMGLNLPTGIPFEYSLDENLKPLVSMKFLGDEETVKKAMDAVASQGKAK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtatacctcatttacaaaacaatttgttaaaacaatcgaacaatcaagaatatggtgt
acaacctccaagaacatttctcataaaaataattgcgatattgctaaagggtcgacgtgc
aaaacttataaaattgtaatgatacgccacggagagagcgattggaataaaaaaaatttg
ttctgtggttggtatgatgccagcctgagttcaaaaggcgtagaagaagctatttcggct
gggaaaacactaaaacaacgttgctacgagtttgatgtcgcccacacttccgtcttgaag
agggccgaagacactttgtgtaacattctaaacctagtagatccaaaaaacagttgcaca
gtgcacaaaaattggcgactgaacgagcggcattacggaagtctgaccggcctcaataag
tctgagacggcaaagaagtacggcgaagacaaggtcaaattgtggaggcgtagttttgac
atcccaccaccgccaatggaggttgatcacccttactactgtcacataaaaaacgacccc
cgttatgtagacggtccctccgagtgtgagttcccaacacatgaatcgttaaaaatgacg
attcaaaggacattgccgtactgggacaacgtgatcgtccctcagatcaaaaatgggtgt
cggattataatagcagctcacggaaacagcctcaggggcataataaaacatttagataat
atcacagacgaagggattatggggttgaacttaccaacgggtataccatttgaatattcg
ctcgacgagaatttaaaaccactggtttctatgaagtttttgggtgacgaagaaaccgta
aaaaaggcaatggatgccgtagcttctcagggcaaagcaaaatga

DBGET integrated database retrieval system