KEGG   Acyrthosiphon pisum (pea aphid): 100162303Help
Entry
100162303         CDS       T01076                                 

Definition
phosphoglycerate mutase 1-like
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100162303
   01230 Biosynthesis of amino acids
    100162303
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100162303
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100162303
Enzymes [BR:api01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100162303
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100162303
  Exosomal proteins of melanoma cells
   100162303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 294 aa AA seqDB search
MYTSFTKQFVKTIEQSRIWCTTSKNISHKNNCDIAKGSTCKTYKIVMIRHGESDWNKKNL
FCGWYDASLSSKGVEEAISAGKTLKQRCYEFDVAHTSVLKRAEDTLCNILNLVDPKNSCT
VHKNWRLNERHYGSLTGLNKSETAKKYGEDKVKLWRRSFDIPPPPMEVDHPYYCHIKNDP
RYVDGPSECEFPTHESLKMTIQRTLPYWDNVIVPQIKNGCRIIIAAHGNSLRGIIKHLDN
ITDEGIMGLNLPTGIPFEYSLDENLKPLVSMKFLGDEETVKKAMDAVASQGKAK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtatacctcatttacaaaacaatttgttaaaacaatcgaacaatcaagaatatggtgt
acaacctccaagaacatttctcataaaaataattgcgatattgctaaagggtcgacgtgc
aaaacttataaaattgtaatgatacgccacggagagagcgattggaataaaaaaaatttg
ttctgtggttggtatgatgccagcctgagttcaaaaggcgtagaagaagctatttcggct
gggaaaacactaaaacaacgttgctacgagtttgatgtcgcccacacttccgtcttgaag
agggccgaagacactttgtgtaacattctaaacctagtagatccaaaaaacagttgcaca
gtgcacaaaaattggcgactgaacgagcggcattacggaagtctgaccggcctcaataag
tctgagacggcaaagaagtacggcgaagacaaggtcaaattgtggaggcgtagttttgac
atcccaccaccgccaatggaggttgatcacccttactactgtcacataaaaaacgacccc
cgttatgtagacggtccctccgagtgtgagttcccaacacatgaatcgttaaaaatgacg
attcaaaggacattgccgtactgggacaacgtgatcgtccctcagatcaaaaatgggtgt
cggattataatagcagctcacggaaacagcctcaggggcataataaaacatttagataat
atcacagacgaagggattatggggttgaacttaccaacgggtataccatttgaatattcg
ctcgacgagaatttaaaaccactggtttctatgaagtttttgggtgacgaagaaaccgta
aaaaaggcaatggatgccgtagcttctcagggcaaagcaaaatga

DBGET integrated database retrieval system