KEGG   Acyrthosiphon pisum (pea aphid): 100163752Help
Entry
100163752         CDS       T01076                                 

Gene name
clk
Definition
clock (EC:2.3.1.48)
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Circadian rhythm - fly
Class
Organismal Systems; Environmental adaptation; Circadian rhythm - fly [PATH:api04711]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 613 aa AA seqDB search
MSNYMSSASTRKSDDQYDDEPTDRVDTKRKIRNASEKNRRDQFNNLINELNRMLSTTNRK
MDKSTVLKTTINYLNKQKDILLKSKVHEIDNDWKPAFLLNEEFTHIILEALDGFMIVFTS
LGKILHASETVTALLGYLPKTMENLSIFKIIHEADHSLLQDQIVESRLSKNYDNDRIVFS
CHCKRHDPFKDKEEINEKNQFELVQFFGYFQPSSEIYHGDNLKMSSPFNSDEDDQNLVFV
GIGRIMTPQLLKELPVMEDIKSEFTSRHSLEWKFLFLDHRGPSIIGYMPFEVLGTSGYEY
YHIDDLEDVILSHQALMLKGEGTSCYYRFLTKGQQWIWLQSRYYISYHQWNSKPEFIVCH
HQVINYFNVIKKEGETNDRRKNSKKRLWHIPLNEIEHQSSNSDYDSYQKRHYEQSSTDSS
KMKIRSIEDIRNSNSEVESLTLVESKHDVTETLNNYLENAQSSVKLPAGSVSPSQENLIQ
DQLQRKQEELQKTIVKQQEELKKITKQLLMARCGILPTFMDDSLQTSTQTSEQTTQPEIS
TNQIICSNTSGELFETRPLISSDVLLLHERNEQVMQNSYSSNIVQNMVDEGGGQLDYSFS
NQSNDVLFEQSSP
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaactacatgagtagtgcctccactagaaaatccgatgaccagtatgatgatgaa
ccgacagatagagtcgatactaaaaggaaaataagaaacgcaagtgagaagaatcgcagg
gatcaatttaacaacttaatcaatgaattaaatcgtatgttgtccacaaccaatagaaaa
atggataagtccactgttttgaaaacaaccataaattatttaaataaacagaaagatata
ttattgaaatcaaaagtacatgaaatagacaatgattggaagccagcatttctattaaat
gaagaattcacacatataattttagaagctttggatggattcatgatagtatttacatca
ttaggaaagatcctccatgcatcagaaactgtcactgcacttcttggttatcttccgaaa
accatggaaaatttatcaatatttaaaataattcatgaagcagatcattcgttattacaa
gatcaaattgtagagtccagactttcaaagaattatgataacgatcgaatcgtattttct
tgtcattgtaagagacatgacccatttaaagataaagaagaaataaatgaaaaaaatcaa
tttgaattagtgcaattttttggttactttcaaccaagtagtgaaatttatcatggggac
aatcttaaaatgtcatctccatttaacagtgatgaagatgaccaaaatctagtatttgtt
ggtattggccgaattatgactccacagttattaaaagaactacctgttatggaggatata
aaaagtgaattcacctcaagacacagtttagaatggaaatttttatttcttgatcataga
ggcccctcaattattgggtatatgccgtttgaagtactgggaacttctggttatgagtat
taccatattgatgacttagaagatgtaatattgtcacaccaagcacttatgctaaaaggt
gaaggaacatcttgttattatcggtttttaaccaaaggccaacaatggatatggttacaa
tcaagatattatattagttaccaccaatggaactcaaaacccgaattcattgtttgtcat
catcaagtcatcaattattttaatgttattaaaaaagaaggtgagactaacgacaggaga
aaaaatagtaaaaaaagattatggcacattcctttaaatgaaattgaacatcaatcatca
aatagtgattatgattcatatcaaaagagacattatgaacaatcaagtacagactcatca
aaaatgaaaattagatcaattgaagatattcgaaattctaattctgaagtcgagtcattg
acattggtagaaagtaaacatgatgttactgaaacattgaacaattatttagaaaatgca
caatcttcagtaaaattacctgcaggctcagtttctccatcacaggaaaatcttattcaa
gatcaattacaacgtaaacaagaggaattacaaaaaactattgtcaagcaacaggaagaa
ctaaagaaaataactaaacaattattaatggctcgatgtggaattttgccaacatttatg
gacgattctttacaaacatccacacagacttccgagcaaacaactcaaccagaaatttct
accaaccaaataatttgttccaatactagtggagaactttttgaaacacgtccattaata
tcttctgatgtcttattattacacgaacgaaatgaacaagttatgcagaattcctattca
tcaaatatagtacagaatatggtcgatgagggaggaggacaattggattatagttttagt
aatcagtctaatgatgttcttttcgaacaaagttctccctga

DBGET integrated database retrieval system