KEGG   Acyrthosiphon pisum (pea aphid): 100164899Help
Entry
100164899         CDS       T01076                                 

Definition
alanine aminotransferase 2
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100164899
   01210 2-Oxocarboxylic acid metabolism
    100164899
   01230 Biosynthesis of amino acids
    100164899
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100164899
Enzymes [BR:api01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     100164899
Amino acid related enzymes [BR:api01007]
 Aminotransferase (transaminase)
  Class I
   100164899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 527 aa AA seqDB search
MSLQRLNKFVRCSANYNVCRYVKSQLEFSQFLRLSVNSKNFSTGQNMSSNQKVLNLDNMN
PNVRIMEYAVRGPLLIRATEIENELKKGIEKPFKEVLKANIGDCHAMGQKPITFIRQVLA
LVSQPELLEDDRYPEDVKERARTILDGCRGGSVGSYTDSPGIEIIRKHVARYIERRDGIP
CDYLNVLLCAGASDGIKAILRLLVADVDGKKPGVLIPIPQYPLYSATLAEFNVKQVGYFL
DENKNWGLDVNELERSITEARKHCNPRAIVVINPGNPTGQVLTKENVVDVIKFAYKEKLF
LLADEVYQDNVYAEGSTFYSFKKVLTELGSPYSEMELASFMSCSKGYMGECGLRGGYTEV
INLDPEVKAMLLKSVSAMLCPTVLGQTVMDCVVNPPQPGEPSYESFQKEKNCVLKSLAER
AKLVADTFNSIPGMSCNPVQGAMYAFPLFKLPEKAIKEAKNQGIEPNAFYAFQLLENTGI
CIVPGSGFGQVEGTYHFRTTILPQPDKLKNMLDNFKDFHLKFLEQWK
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgcaaaggctaaataaatttgtcagatgttcggcaaactacaatgtatgccgt
tatgtcaagtcacaattagaattttcccaatttttgaggttgtctgtgaattcaaagaac
ttttccaccggccaaaatatgtcgtcgaatcagaaggtattaaatttagacaatatgaac
ccaaacgtaaggataatggaatacgctgttcgaggaccgttattgataagagctacagaa
attgaaaacgaattgaaaaagggtattgaaaaaccttttaaagaagtgcttaaagcaaat
attggtgattgccatgcaatgggacaaaagccaattacattcatacgccaggttttagct
ttggtatctcaaccagaactgttggaagatgatcgatatcctgaagatgttaaagaacgt
gcaagaactatattagatggatgtcgcggtggaagtgttggttcttatactgattctcca
ggaatagaaataataagaaaacatgttgcccgatatattgaacgtcgagatggtattcca
tgtgattatttaaatgtcctcttgtgtgctggtgcatcagatggaataaaagctattcta
cgattattggttgccgatgttgatggaaaaaaacctggtgtattaattcctattccacaa
tacccattatactctgctacattagcagagtttaatgtaaaacaggttggatacttttta
gatgaaaataaaaattggggtttggatgtgaatgaattagaacgatcaataactgaagca
cgcaaacattgtaaccctagagctattgtggttattaatcccggcaatccaactggccaa
gtattaaccaaagaaaatgtggtggatgttattaaatttgcatataaagaaaaattgttc
ttacttgctgatgaggtatatcaagacaatgtgtacgcggaaggaagtacattttattca
tttaaaaaagtattaactgaattaggatctccttatagtgaaatggaattggcatcattt
atgtcttgttctaaaggttatatgggagaatgtggtctaagaggtggttacacagaagtg
attaatttggatccggaagttaaagcaatgttactcaaatctgtgtcagctatgttatgt
cctacagttcttggccaaactgtgatggactgtgttgtaaatcctccacaaccaggtgaa
ccatcgtatgagagttttcaaaaagaaaaaaattgcgtactaaaatctttagcagaaaga
gctaaattggtagctgatacatttaatagtattcctgggatgtcttgcaatccagtgcaa
ggcgcaatgtatgcttttccattattcaagttacctgaaaaagcaattaaagaagcaaaa
aatcaaggaattgaacccaatgcattctatgcgtttcaacttttggaaaatactggtatt
tgtattgtgcctggatctggatttggacaagttgaaggaacttatcattttagaactaca
atccttcctcagccagataaattgaaaaatatgttggacaatttcaaagattttcattta
aaatttttagaacaatggaaataa

DBGET integrated database retrieval system