KEGG   Acyrthosiphon pisum (pea aphid): 100164899Help
Entry
100164899         CDS       T01076                                 

Definition
(RefSeq) alanine aminotransferase 2
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00220  Arginine biosynthesis
api00250  Alanine, aspartate and glutamate metabolism
api01100  Metabolic pathways
api01200  Carbon metabolism
api01210  2-Oxocarboxylic acid metabolism
api01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100164899
   00220 Arginine biosynthesis
    100164899
Enzymes [BR:api01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     100164899
Amino acid related enzymes [BR:api01007]
 Aminotransferase (transaminase)
  Class I
   100164899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Nitr_red_bet_C
Motif
Other DBs
NCBI-GeneID: 100164899
NCBI-ProteinID: XP_001948711
APHIDBASE: ACYPI005880
UniProt: J9JZJ2
Position
Un
AA seq 527 aa AA seqDB search
MSLQRLNKFVRCSANYNVCRYVKSQLEFSQFLRLSVNSKNFSTGQNMSSNQKVLNLDNMN
PNVRIMEYAVRGPLLIRATEIENELKKGIEKPFKEVLKANIGDCHAMGQKPITFIRQVLA
LVSQPELLEDDRYPEDVKERARTILDGCRGGSVGSYTDSPGIEIIRKHVARYIERRDGIP
CDYLNVLLCAGASDGIKAILRLLVADVDGKKPGVLIPIPQYPLYSATLAEFNVKQVGYFL
DENKNWGLDVNELERSITEARKHCNPRAIVVINPGNPTGQVLTKENVVDVIKFAYKEKLF
LLADEVYQDNVYAEGSTFYSFKKVLTELGSPYSEMELASFMSCSKGYMGECGLRGGYTEV
INLDPEVKAMLLKSVSAMLCPTVLGQTVMDCVVNPPQPGEPSYESFQKEKNCVLKSLAER
AKLVADTFNSIPGMSCNPVQGAMYAFPLFKLPEKAIKEAKNQGIEPNAFYAFQLLENTGI
CIVPGSGFGQVEGTYHFRTTILPQPDKLKNMLDNFKDFHLKFLEQWK
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgcaaaggctaaataaatttgtcagatgttcggcaaactacaatgtatgccgt
tatgtcaagtcacaattagaattttcccaatttttgaggttgtctgtgaattcaaagaac
ttttccaccggccaaaatatgtcgtcgaatcagaaggtattaaatttagacaatatgaac
ccaaacgtaaggataatggaatacgctgttcgaggaccgttattgataagagctacagaa
attgaaaacgaattgaaaaagggtattgaaaaaccttttaaagaagtgcttaaagcaaat
attggtgattgccatgcaatgggacaaaagccaattacattcatacgccaggttttagct
ttggtatctcaaccagaactgttggaagatgatcgatatcctgaagatgttaaagaacgt
gcaagaactatattagatggatgtcgcggtggaagtgttggttcttatactgattctcca
ggaatagaaataataagaaaacatgttgcccgatatattgaacgtcgagatggtattcca
tgtgattatttaaatgtcctcttgtgtgctggtgcatcagatggaataaaagctattcta
cgattattggttgccgatgttgatggaaaaaaacctggtgtattaattcctattccacaa
tacccattatactctgctacattagcagagtttaatgtaaaacaggttggatacttttta
gatgaaaataaaaattggggtttggatgtgaatgaattagaacgatcaataactgaagca
cgcaaacattgtaaccctagagctattgtggttattaatcccggcaatccaactggccaa
gtattaaccaaagaaaatgtggtggatgttattaaatttgcatataaagaaaaattgttc
ttacttgctgatgaggtatatcaagacaatgtgtacgcggaaggaagtacattttattca
tttaaaaaagtattaactgaattaggatctccttatagtgaaatggaattggcatcattt
atgtcttgttctaaaggttatatgggagaatgtggtctaagaggtggttacacagaagtg
attaatttggatccggaagttaaagcaatgttactcaaatctgtgtcagctatgttatgt
cctacagttcttggccaaactgtgatggactgtgttgtaaatcctccacaaccaggtgaa
ccatcgtatgagagttttcaaaaagaaaaaaattgcgtactaaaatctttagcagaaaga
gctaaattggtagctgatacatttaatagtattcctgggatgtcttgcaatccagtgcaa
ggcgcaatgtatgcttttccattattcaagttacctgaaaaagcaattaaagaagcaaaa
aatcaaggaattgaacccaatgcattctatgcgtttcaacttttggaaaatactggtatt
tgtattgtgcctggatctggatttggacaagttgaaggaacttatcattttagaactaca
atccttcctcagccagataaattgaaaaatatgttggacaatttcaaagattttcattta
aaatttttagaacaatggaaataa

DBGET integrated database retrieval system