KEGG   Acyrthosiphon pisum (pea aphid): 100164899Help
Entry
100164899         CDS       T01076                                 

Definition
alanine aminotransferase 2-like
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:api01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:api01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:api01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:api00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 527 aa AA seqDB search
MSLQRLNKFVRCSANYNVCRYVKSQLEFSQFLRLSVNSKNFSTGQNMSSNQKVLNLDNMN
PNVRIMEYAVRGPLLIRATEIENELKKGIEKPFKEVLKANIGDCHAMGQKPITFIRQVLA
LVSQPELLEDDRYPEDVKERARTILDGCRGGSVGSYTDSPGIEIIRKHVARYIERRDGIP
CDYLNVLLCAGASDGIKAILRLLVADVDGKKPGVLIPIPQYPLYSATLAEFNVKQVGYFL
DENKNWGLDVNELERSITEARKHCNPRAIVVINPGNPTGQVLTKENVVDVIKFAYKEKLF
LLADEVYQDNVYAEGSTFYSFKKVLTELGSPYSEMELASFMSCSKGYMGECGLRGGYTEV
INLDPEVKAMLLKSVSAMLCPTVLGQTVMDCVVNPPQPGEPSYESFQKEKNCVLKSLAER
AKLVADTFNSIPGMSCNPVQGAMYAFPLFKLPEKAIKEAKNQGIEPNAFYAFQLLENTGI
CIVPGSGFGQVEGTYHFRTTILPQPDKLKNMLDNFKDFHLKFLEQWK
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgcaaaggctaaataaatttgtcagatgttcggcaaactacaatgtatgccgt
tatgtcaagtcacaattagaattttcccaatttttgaggttgtctgtgaattcaaagaac
ttttccaccggccaaaatatgtcgtcgaatcagaaggtattaaatttagacaatatgaac
ccaaacgtaaggataatggaatacgctgttcgaggaccgttattgataagagctacagaa
attgaaaacgaattgaaaaagggtattgaaaaaccttttaaagaagtgcttaaagcaaat
attggtgattgccatgcaatgggacaaaagccaattacattcatacgccaggttttagct
ttggtatctcaaccagaactgttggaagatgatcgatatcctgaagatgttaaagaacgt
gcaagaactatattagatggatgtcgcggtggaagtgttggttcttatactgattctcca
ggaatagaaataataagaaaacatgttgcccgatatattgaacgtcgagatggtattcca
tgtgattatttaaatgtcctcttgtgtgctggtgcatcagatggaataaaagctattcta
cgattattggttgccgatgttgatggaaaaaaacctggtgtattaattcctattccacaa
tacccattatactctgctacattagcagagtttaatgtaaaacaggttggatacttttta
gatgaaaataaaaattggggtttggatgtgaatgaattagaacgatcaataactgaagca
cgcaaacattgtaaccctagagctattgtggttattaatcccggcaatccaactggccaa
gtattaaccaaagaaaatgtggtggatgttattaaatttgcatataaagaaaaattgttc
ttacttgctgatgaggtatatcaagacaatgtgtacgcggaaggaagtacattttattca
tttaaaaaagtattaactgaattaggatctccttatagtgaaatggaattggcatcattt
atgtcttgttctaaaggttatatgggagaatgtggtctaagaggtggttacacagaagtg
attaatttggatccggaagttaaagcaatgttactcaaatctgtgtcagctatgttatgt
cctacagttcttggccaaactgtgatggactgtgttgtaaatcctccacaaccaggtgaa
ccatcgtatgagagttttcaaaaagaaaaaaattgcgtactaaaatctttagcagaaaga
gctaaattggtagctgatacatttaatagtattcctgggatgtcttgcaatccagtgcaa
ggcgcaatgtatgcttttccattattcaagttacctgaaaaagcaattaaagaagcaaaa
aatcaaggaattgaacccaatgcattctatgcgtttcaacttttggaaaatactggtatt
tgtattgtgcctggatctggatttggacaagttgaaggaacttatcattttagaactaca
atccttcctcagccagataaattgaaaaatatgttggacaatttcaaagattttcattta
aaatttttagaacaatggaaataa

DBGET integrated database retrieval system