KEGG   Acyrthosiphon pisum (pea aphid): 100167212Help
Entry
100167212         CDS       T01076                                 

Definition
(RefSeq) serine/threonine-protein kinase Aurora-2
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100167212
Protein kinases [BR:api01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   100167212
Protein phosphatases and associated proteins [BR:api01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100167212
Chromosome [BR:api03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100167212
   Spindle formation proteins
    100167212
  Sister chromatid separation proteins
   Aurora kinases
    100167212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
APHIDBASE: 
UniProt: 
Position
Un
AA seq 442 aa AA seqDB search
MSSYALKSKENRIQRPRPPPVTAAASNVASSAPRRTVGFGTTTNTVTVAKPIGAQYRRSV
STTINKTPDLLHPPKFGGQQLSNRSCKPDITKNLPSKTVQKPPSQPCEPVAQSRVPPKEI
FKIPTVANIPKKATQVANPPTTVNQLQNNLKAATLDEKPSTDQQNNKNMGLTDKKNEMKW
TLENFDIGKALGKGKFGNVYLAREKSSGFIVALKVLFKTQILKANVEHQLKREIEIQTHL
RHPNIVRMFGYFHDDARVYMILEYAPKQLYKELQAQENQRFSEDRAAFYIKQLTEALIYC
HDKNIIHRDIKPENLLLTKGGDLKIADFGWSVHTRDSKRMTLCGTLDYLPPEMVSGNSHD
KSVDVWSVGVLLYEILVGKPPFEASTYEETYKRILNAQYIFPQHVAPLARDLISRLLRVK
PETRLPLKDLLLHDWIKIHTNL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagtagttacgcactcaagtcaaaagaaaacagaatacagaggccacgaccgccgccg
gtaaccgccgcggcttctaatgtggcttcgtccgcgccccgtcgcaccgtgggtttcggg
acgaccacgaacaccgtcacggttgctaaaccgattggtgcgcagtaccgtcgatccgtg
tctacaactattaacaagacaccggatctactacaccctcccaagtttggcggccaacag
ctctccaaccgcagttgcaagccggacatcactaaaaatctgccctccaaaaccgttcaa
aaaccaccgtcacagccgtgtgaaccggtggcccagtcaagggttccccccaaagaaata
tttaaaattccaactgttgctaatataccaaaaaaagctacacaagtggccaatccacct
acaacagtcaatcaactccagaacaatttgaaggcagccacccttgatgaaaaaccttct
actgatcaacaaaacaataaaaacatgggactaacagataaaaaaaatgaaatgaaatgg
acattggaaaattttgatattggtaaagcattgggaaaaggaaaatttggaaatgtgtat
cttgccagagaaaagagttctggatttattgttgctcttaaagttttatttaaaacgcaa
attttaaaagcaaatgttgagcaccagctcaaaagagaaattgaaattcaaacacatcta
aggcaccctaatattgtacgtatgtttggttatttccatgatgatgctagagtatatatg
atcctagaatatgcacctaaacagctgtacaaagaattgcaagctcaagaaaatcaacgt
ttctctgaagatagggcagcattttatattaagcaattaacagaagcgttgatttattgc
catgataaaaatattatacatcgtgatataaaaccagagaatcttttacttaccaaagga
ggtgacttgaaaattgctgattttgggtggtccgtacatacacgggattcaaagcgcatg
acattatgtggaaccttggactatttgccaccagaaatggtgagtggaaactctcatgac
aaatcagtcgatgtttggagcgtaggtgtattattatatgagattttagttggcaaacca
ccttttgaagcttcgacgtatgaagaaacgtataaaaggatattaaatgctcaatatatt
ttcccgcaacatgttgctccactggctcgagatctcatatcacgtttattaagagtgaaa
ccagagactcgtttacctctcaaagatctgttactacatgactggataaaaatacacaca
aacctctaa

DBGET integrated database retrieval system