KEGG   Acyrthosiphon pisum (pea aphid): 100167212Help
Entry
100167212         CDS       T01076                                 

Definition
serine/threonine-protein kinase Aurora-2-like
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100167212
Protein kinases [BR:api01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   100167212
Protein phosphatases and associated proteins [BR:api01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100167212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 442 aa AA seqDB search
MSSYALKSKENRIQRPRPPPVTAAASNVASSAPRRTVGFGTTTNTVTVAKPIGAQYRRSV
STTINKTPDLLHPPKFGGQQLSNRSCKPDITKNLPSKTVQKPPSQPCEPVAQSRVPPKEI
FKIPTVANIPKKATQVANPPTTVNQLQNNLKAATLDEKPSTDQQNNKNMGLTDKKNEMKW
TLENFDIGKALGKGKFGNVYLAREKSSGFIVALKVLFKTQILKANVEHQLKREIEIQTHL
RHPNIVRMFGYFHDDARVYMILEYAPKQLYKELQAQENQRFSEDRAAFYIKQLTEALIYC
HDKNIIHRDIKPENLLLTKGGDLKIADFGWSVHTRDSKRMTLCGTLDYLPPEMVSGNSHD
KSVDVWSVGVLLYEILVGKPPFEASTYEETYKRILNAQYIFPQHVAPLARDLISRLLRVK
PETRLPLKDLLLHDWIKIHTNL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagtagttacgcactcaagtcaaaagaaaacagaatacagaggccacgaccgccgccg
gtaaccgccgcggcttctaatgtggcttcgtccgcgccccgtcgcaccgtgggtttcggg
acgaccacgaacaccgtcacggttgctaaaccgattggtgcgcagtaccgtcgatccgtg
tctacaactattaacaagacaccggatctactacaccctcccaagtttggcggccaacag
ctctccaaccgcagttgcaagccggacatcactaaaaatctgccctccaaaaccgttcaa
aaaccaccgtcacagccgtgtgaaccggtggcccagtcaagggttccccccaaagaaata
tttaaaattccaactgttgctaatataccaaaaaaagctacacaagtggccaatccacct
acaacagtcaatcaactccagaacaatttgaaggcagccacccttgatgaaaaaccttct
actgatcaacaaaacaataaaaacatgggactaacagataaaaaaaatgaaatgaaatgg
acattggaaaattttgatattggtaaagcattgggaaaaggaaaatttggaaatgtgtat
cttgccagagaaaagagttctggatttattgttgctcttaaagttttatttaaaacgcaa
attttaaaagcaaatgttgagcaccagctcaaaagagaaattgaaattcaaacacatcta
aggcaccctaatattgtacgtatgtttggttatttccatgatgatgctagagtatatatg
atcctagaatatgcacctaaacagctgtacaaagaattgcaagctcaagaaaatcaacgt
ttctctgaagatagggcagcattttatattaagcaattaacagaagcgttgatttattgc
catgataaaaatattatacatcgtgatataaaaccagagaatcttttacttaccaaagga
ggtgacttgaaaattgctgattttgggtggtccgtacatacacgggattcaaagcgcatg
acattatgtggaaccttggactatttgccaccagaaatggtgagtggaaactctcatgac
aaatcagtcgatgtttggagcgtaggtgtattattatatgagattttagttggcaaacca
ccttttgaagcttcgacgtatgaagaaacgtataaaaggatattaaatgctcaatatatt
ttcccgcaacatgttgctccactggctcgagatctcatatcacgtttattaagagtgaaa
ccagagactcgtttacctctcaaagatctgttactacatgactggataaaaatacacaca
aacctctaa

DBGET integrated database retrieval system