KEGG   Anas platyrhynchos (mallard): 101793381Help
Entry
101793381         CDS       T02816                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:apla00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 648 aa AA seqDB search
MQTSSSKKCPCLGFKLREVASVYFTMVAVFLVILVVALQGSAPRGTYFPYKVPLDPQGLL
ELSWNVSYPEQAVYFQILSRELKFGLLFGMSDRGEFENADLAVLWSDGHSSYFGDAWSDA
KGHLHMDSQQDYQLLGAQSAAEGLYILFRRAFSTCDPKDYLIEDGTVHLIYGILEQPVRS
LQAINISAIHRGLQRVQLLKPNITIPELPSDMKTMEITAPGVVIPSQETTYWCYMAELPD
GFAKHHIVMYEPVITAGNEALVHHMEVFQCAAELDSIPPYNGPCDAKMKPEQLNYCRHVL
AAWAMGXQAFYYPEEAGLAFGGPGSSRYLRLEVHYHNPLVFKGRRDSSGIRLYYTGSLRR
YDAGIMELGLVYTPVMAVPPGETAFVLTGYCTDKCTQRVTLPAAGIRIFASQLHTHLAGR
KVVTVLARDGRERQGGERXXXFCPPSQEIRMLKELVAVFPGDELITACTYNTEDRTKVTV
GGFGIMEEMCVNYVHYYPQTQLELCKSAVDPGYLHRYFSLVNRFNDEEVCTCPQVSVPQQ
FSSIPWNAFNRDVLKSLYGFAPISMHCNKSTAVRFPGEWEKQPLPSITETLREPVPHCPP
ARPRASSCCLRAHQAGGDQEGLSRFLAKEPKWVLKRTENKRTQSEGTK
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgcagacctccagcagcaagaagtgcccctgcctcggcttcaagctgcgggaggtggcg
tccgtgtacttcaccatggtcgccgtcttcttggtcatcctggtggtcgccctgcagggc
tcggcgccccgtggcacctattttccctacaaggtgcccctcgatccccaggggctgctc
gagctctcctggaacgtcagctaccccgagcaagccgtgtacttccagatcctcagcagg
gaactcaaattcgggctcctcttcgggatgtcggaccggggagagtttgagaatgcggac
ctggccgtgctctggagcgacgggcacagctcgtattttggggatgcctggagcgatgcc
aaggggcacctccacatggactcgcagcaggactaccagctcctgggggctcagagcgcc
gccgaggggctctacatcctcttcagaagagccttcagcacctgtgaccccaaggactac
cttatagaggatggcaccgtgcacctcatctatgggatcctggagcaacccgtccgctcc
ctgcaggccatcaacatctctgccatccacagggggctgcagagggtgcagctgctaaag
cccaacatcaccatccccgagctgcccagcgacatgaagaccatggagattacggccccc
ggtgttgttatccccagccaggagacgacctactggtgttacatggcagagctgccagac
ggcttcgccaagcaccacatcgtcatgtacgagccggtgatcacggcgggcaacgaagcc
ctggtgcaccacatggaagtcttccagtgtgccgccgagctggacagcatcccgccgtac
aacgggccctgcgacgccaagatgaagccagagcagctcaactactgccggcacgtgctt
gccgcctgggccatgggcntccaggctttctactaccccgaagaagcagggcttgccttt
ggtggtccgggctcctccagatacctgcgccttgaggttcactatcacaaccccctggtg
ttcaaagggcgccgtgattcctcggggatccgcctctactacacgggcagcctgcgccgc
tacgatgctggcatcatggagctgggcttggtctacacgccggtgatggccgtgcccccg
ggcgagaccgccttcgtcctcaccgggtactgcaccgacaagtgcacccagcgggtgaca
ctgcctgctgccggcatccgcatcttcgcctcgcagctccacacgcacctggcagggagg
aaagtggtgacggtgctggcacgggacggcagggagaggcaggggggtgagcgnnnnnnn
nctttttgtcctccctcgcaggagatccgcatgctgaaggagctggttgcagtttttccg
ggtgatgaactcatcacagcctgcacctacaacacggaggacaggaccaaagtgaccgtg
ggcgggtttggcatcatggaggagatgtgcgtgaactacgtgcactactacccacagacc
cagctggagctctgcaaaagcgccgtggatccgggctacctgcaccgctacttcagcctc
gtgaacaggttcaatgacgaggaggtctgcacgtgcccgcaggtctccgtcccgcagcag
ttttcctccatcccctggaacgccttcaacagagacgtgttaaaatccctctatggcttc
gcccccatctccatgcactgcaacaaatccacggccgtccgcttcccgggcgagtgggag
aagcagccgcttcccagcatcaccgagacgctgcgggagcccgttcctcactgcccgccc
gcccgccccagggcctcatcctgctgcctccgtgcccatcaagctgggggagatcaagag
ggtctgagccgattcctggcgaaggaaccgaaatgggttctcaagagaacagaaaacaag
cgaacccagtcggagggaacgaaatga

DBGET integrated database retrieval system