KEGG   Anas platyrhynchos (mallard): 101793381Help
Entry
101793381         CDS       T02816                                 

Gene name
DBH
Definition
(RefSeq) dopamine beta-hydroxylase (dopamine beta-monooxygenase)
  KO
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    101793381 (DBH)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     101793381 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 684 aa AA seqDB search
MAKARRAAAVLPSMQTSSSKKCPCLGFKLREVASVYFTMVAVFLVILVVALQGSAPRGTY
FPYKVPLDPQGLLELSWNVSYPEQAVYFQILSRELKFGLLFGMSDRGEFENADLAVLWSD
GHSSYFGDAWSDAKGHLHMDSQQDYQLLGAQSAAEGLYILFRRAFSTCDPKDYLIEDGTV
HLIYGILEQPVRSLQAINISAIHRGLQRVQLLKPNITIPELPSDMKTMEITAPGVVIPSQ
ETTYWCYMAELPDGFAKHHIVMYEPVITAGNEALVHHMEVFQCAAELDSIPPYNGPCDAK
MKPEQLNYCRHVLAAWAMGXQAFYYPEEAGLAFGGPGSSRYLRLEVHYHNPLVFKGRRDS
SGIRLYYTGSLRRYDAGIMELGLVYTPVMAVPPGETAFVLTGYCTDKCTQRALPAAGIRI
FASQLHTHLAGRKVVTVLARDGRERQGVPGTAPCGRVAPMGHPVPWAQRGAGARHRSDPV
PFCPPSQEIRMLKELVAVFPGDELITACTYNTEDRTKVTVGGFGIMEEMCVNYVHYYPQT
QLELCKSAVDPGYLHRYFSLVNRFNDEEVCTCPQVSVPQQFSSIPWNAFNRDVLKSLYGF
APISMHCNKSTAVRFPGEWEKQPLPSITETLREPVPHCPPARPRASSCCLRAHQAGGDQE
GLSRFLVPLGVPAPRWDAPLPGGR
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagccaggagggcggctgccgtcctgcccagcatgcagacctccagcagcaag
aagtgcccctgcctcggcttcaagctgcgggaggtggcgtccgtgtacttcaccatggtc
gccgtcttcttggtcatcctggtggtcgccctgcagggctcggcgccccgtggcacctat
tttccctacaaggtgcccctcgatccccaggggctgctcgagctctcctggaacgtcagc
taccccgagcaagccgtgtacttccagatcctcagcagggaactcaaattcgggctcctc
ttcgggatgtcggaccggggagagtttgagaatgcggacctggccgtgctctggagcgac
gggcacagctcgtattttggggatgcctggagcgatgccaaggggcacctccacatggac
tcgcagcaggactaccagctcctgggggctcagagcgccgccgaggggctctacatcctc
ttcagaagagccttcagcacctgtgaccccaaggactaccttatagaggatggcaccgtg
cacctcatctatgggatcctggagcaacccgtccgctccctgcaggccatcaacatctct
gccatccacagggggctgcagagggtgcagctgctaaagcccaacatcaccatccccgag
ctgcccagcgacatgaagaccatggagattacggcccccggtgttgttatccccagccag
gagacgacctactggtgttacatggcagagctgccagacggcttcgccaagcaccacatc
gtcatgtacgagccggtgatcacggcgggcaacgaagccctggtgcaccacatggaagtc
ttccagtgtgccgccgagctggacagcatcccgccgtacaacgggccctgcgacgccaag
atgaagccagagcagctcaactactgccggcacgtgcttgccgcctgggccatgggcntc
caggctttctactaccccgaagaagcagggcttgcctttggtggtccgggctcctccaga
tacctgcgccttgaggttcactatcacaaccccctggtgttcaaagggcgccgtgattcc
tcggggatccgcctctactacacgggcagcctgcgccgctacgatgctggcatcatggag
ctgggcttggtctacacgccggtgatggccgtgcccccgggcgagaccgccttcgtcctc
accgggtactgcaccgacaagtgcacccagcgggcactgcctgctgccggcatccgcatc
ttcgcctcgcagctccacacgcacctggcagggaggaaagtggtgacggtgctggcacgg
gacggcagggagaggcagggggttccaggtacggcgccatgcgggcgggtggcacccatg
ggacacccagtcccgtgggcacagaggggtgctggggcacggcaccgctctgacccggtg
cctttttgtcctccctcgcaggagatccgcatgctgaaggagctggttgcagtttttccg
ggtgatgaactcatcacagcctgcacctacaacacggaggacaggaccaaagtgaccgtg
ggcgggtttggcatcatggaggagatgtgcgtgaactacgtgcactactacccacagacc
cagctggagctctgcaaaagcgccgtggatccgggctacctgcaccgctacttcagcctc
gtgaacaggttcaatgacgaggaggtctgcacgtgcccgcaggtctccgtcccgcagcag
ttttcctccatcccctggaacgccttcaacagagacgtgttaaaatccctctatggcttc
gcccccatctccatgcactgcaacaaatccacggccgtccgcttcccgggcgagtgggag
aagcagccgcttcccagcatcaccgagacgctgcgggagcccgttcctcactgcccgccc
gcccgccccagggcctcatcctgctgcctccgtgcccatcaagctgggggagatcaagag
ggtctgagccgattcctggtcccccttggcgtgccggcaccgcgatgggatgcgcctctg
cccggcggaagataa

DBGET integrated database retrieval system