KEGG   Candidatus Azobacteroides pseudotrichonymphae: CFPG_188Help
Entry
CFPG_188          CDS       T00792                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:aps00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(242932..243690)
Genome map
AA seq 252 aa AA seqDB search
MSLKIKKVLVSQPKPATGKSPYYEIAKKYDLQIDFKPFIKIEPISLREFRRQKINIQDYT
AIVFTAKIAIDHYFRLCRELRFQIPESLKYFCLSETIAVYLQKYIVYRKRKIFFSELATL
EDLIIAICKYDKENFLIPVSNVHGNGLSSLLNKKNIKCSTAVMYRTVSNDFNQDEKFDYD
LLLFFAPAGINSLLKNFPDFKRNDVAIGAFGSATAQAVEQAGLRLAIEAPTPEAPSMVTA
LENYIKKLRKIL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaaagataaagaaggttttagtttctcagcctaagcctgcgacagggaaatct
ccttattatgaaatagcaaaaaagtatgatttacaaattgatttcaaaccttttattaaa
atagaacctatatctttgagagaatttagaagacaaaaaataaatattcaggattatacg
gctattgtttttacagctaaaatagctatagatcattactttcgcttatgtagggaacta
cgatttcaaataccagaatcattaaaatatttctgtttgagtgaaactatagcggtttat
ttgcaaaaatacattgtatatcgtaaacgaaaaatatttttttcagaattggctacatta
gaagatttgataattgcgatttgcaaatatgataaagaaaattttttaattcctgtatcg
aatgtacacgggaatggattgtcaagcctgttaaataaaaaaaatattaaatgtagcaca
gcagttatgtatcgaacagtaagtaatgatttcaaccaagatgaaaaatttgattatgat
ttattattgttctttgctcctgcaggaattaattcactgctaaaaaattttcctgacttt
aagcgaaatgatgttgccataggagcttttggatcggcaactgctcaagcggttgagcaa
gcgggtttgcgtttagctatagaagcacctactccagaggctccttcaatggtcactgct
ttagaaaattacatcaagaaattacgtaaaattttatga

DBGET integrated database retrieval system