KEGG   Acetobacter pasteurianus IFO 3283-32: APA32_03620Help
Entry
APA32_03620       CDS       T01817                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
apz  Acetobacter pasteurianus IFO 3283-32
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:apz01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:apz00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:apz00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:apz00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:apz00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
374509..376497
Genome map
AA seq 662 aa AA seqDB search
MSENITILPTQYADYPALMPPAELAAMQRYARRDPDGFWLQQARRVHWHRKPRRGFTGSF
TGDVSISWFEDGLINASVCCIDKHLTDKADQIALISHREGRAEAEKITYAMLHERVCRLS
NALVHLGVEEGHRVAICLPMISEAVVAMLACARIGAVHVVLFGGFSAEGIAERIIDSGAV
AVITASESMRGNKIVPFKAIMDEALCKAGAESGVRAVLVVRTSDAPVPMLPGRDYDFHDF
VDSFEADFVPVVMRAEAPLFMLYTSGSTGKPKAVVHATGGYMVWAAYTMDMVYHHQPGDV
LWCTADVAWITGHTSVVYGPLANGGTTMISDSLPSYPAPGRWLDLIDEHKVTMLFTAPTA
VRAMMADGDDVVNARNLESLRLLGVAGEPISPDAWLWYHDVVGKKRCPVVDTWWQTETAG
IVLGPVPGVQPLKPGSASTPLPGLEMVIADTQGRPVQGPAEGSLCIARSWPGQARTIWKD
HARFCQTYFGMVPGHYFTGDGARRDADGYYWITGRMDDVINIAGHRLGTAEVEDALAADH
RIVESAAVGIPHPVKGQALAVFVIQRQNVATELTEKGISRLISGMLGRYATPEAVYLVPD
LPRTRSGKIVRRLLRKIASGEMDNLGDLSSLNDPSIVRMLCDRVWSHMAFDEESAPRTQA
RA
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaaacatcactatcctgcctacacagtatgcagattacccggctctgatgcca
cctgcggaactggccgccatgcagcgctatgcacgccgagacccggatggtttttggctg
caacaggcccggcgtgtgcactggcaccgcaagcctaggcgaggctttacgggcagcttt
acgggtgatgtgtccataagctggtttgaagatggccttatcaacgcatccgtatgctgt
attgataagcatctgacagacaaggctgatcagattgcccttatcagccaccgtgaaggc
cgggccgaggcagaaaaaattacatatgccatgctgcatgaacgggtttgccgcctgtct
aacgcgctggtgcatttgggggtggaggaagggcaccgcgttgccatttgcctgcccatg
atttcagaagccgtggtggccatgctggcctgtgcgcgtattggcgcggtgcatgtggtg
ctgtttggtggtttttcggcagaaggtattgcagaacgtattatagatagcggcgcagtt
gcggtaattaccgccagcgaaagcatgcgcggcaacaagatcgtgccctttaaagcgatt
atggatgaagccctgtgcaaggcaggtgcagaaagtggcgtgcgggctgttctagttgtg
cgcacgtctgatgcacctgttcccatgctgcctggtagggattacgattttcatgatttt
gtagattcgtttgaggcagattttgtgcccgttgtcatgcgggcagaagcaccattattt
atgctctacacatctggcagcacaggcaagcccaaagcagttgtgcatgccactggtggc
tatatggtgtgggcagcttacactatggacatggtgtaccatcatcaacctggtgatgtg
ctgtggtgcacggcagatgtggcatggataaccgggcatacatccgttgtgtatggcccg
ctggccaatggcggaaccaccatgatttccgatagcctgccttcataccccgctccgggc
agatggttggatctgatagatgagcataaggtgaccatgctgtttaccgcccccacagcc
gtgcgcgccatgatggccgatggtgatgatgtggtgaacgcccgcaatctggagtctctg
cgtttgctgggtgtggcgggggagcccataagcccggatgcgtggctatggtatcacgat
gttgtgggtaaaaagcgttgccccgtggtggatacatggtggcagacagaaaccgccggc
attgtgctggggccagtgccgggtgtgcaaccgcttaaacccggctctgccagcacgccg
ctgccggggttggaaatggtcatagccgatacgcagggcaggccggtgcaggggcctgca
gaaggtagcctgtgcattgcgcgttcatggccggggcaggcccgcacaatctggaaagat
catgctcgcttctgccagacatattttggtatggttccggggcattatttcacgggtgat
ggcgcacggcgagatgccgatggctattactggattacggggcgcatggacgatgttatc
aatattgcagggcaccgtttgggtacagcagaagtggaagatgcgttggcagcagatcat
cgtattgtggaatctgctgcagtgggcatcccgcacccggtaaaggggcaggcgctggcg
gtatttgttatccagcgccagaacgtggctacggaactgacagaaaaaggcataagccgc
cttatctccggtatgttggggcgttatgccacgccagaggccgtttatctggtgccagat
ctgcctcgcacgcgctctggcaagattgtacgccgcctgctgcgcaaaattgccagtggg
gaaatggataatctgggagatctttcatcgctgaatgatccttccatcgtgcgtatgctg
tgtgacagagtatggagccacatggcttttgatgaggaatctgcacctcgcacacaggca
agggcctga

DBGET integrated database retrieval system