KEGG   Acetobacter pasteurianus IFO 3283-32: APA32_11170Help
Entry
APA32_11170       CDS       T01817                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
apz  Acetobacter pasteurianus IFO 3283-32
Pathway
apz00040  Pentose and glucuronate interconversions
apz00052  Galactose metabolism
apz00500  Starch and sucrose metabolism
apz00520  Amino sugar and nucleotide sugar metabolism
apz01100  Metabolic pathways
apz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:apz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    APA32_11170
   00052 Galactose metabolism
    APA32_11170
   00500 Starch and sucrose metabolism
    APA32_11170
   00520 Amino sugar and nucleotide sugar metabolism
    APA32_11170
Enzymes [BR:apz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     APA32_11170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: BAI14507
NITE: APA32_11170
Position
1177307..1178197
Genome map
AA seq 296 aa AA seqDB search
MSKPKPLRKAVLPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAIDEAREAGIEEFCLIT
GRGKDSLIDYFDIAYELEDTLRERNKIDCLKALEPSSIEAGSLIAVRQQEPLGLGHAIWC
ARSFIGDDPFAILLPDDIVQAAPGKGCLKQLADAYNETGGSVVAVTEVPREQTNRYGILD
TGKDDGRLVEVKGLVEKPKPEDAPSNLSIIGRYVLTPEVMPYLSKLEKGAGGEVQLTDAM
AKTIGQVPFHGLRYEGTRYDCGNKLGFLEAQVAFALERPDLADGVKEFLKKYTDKI
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaaacccaagcctttacgtaaagcagtcctgcctgttgcgggattgggaacgcgc
tttctgcccgcaaccaaggccatgccaaaggaaatgctgcctgttgttgacaggccgctg
atccagtatgcgattgatgaagcgcgtgaagccgggattgaagagttctgcctgattaca
ggccgcggtaaggactctcttattgattactttgatattgcttacgagctggaagatacg
ctcagagagcgcaacaagattgattgcctgaaagcgctggaacccagctctattgaagca
ggctctcttattgcagtgcgtcagcaggaaccgctgggccttgggcacgctatctggtgc
gcacgttcctttattggggatgatccgttcgccatcctgctgcccgatgatatcgtgcag
gctgcacccggcaagggctgcctgaagcagttggccgatgcgtataatgaaacaggcggt
agcgttgtggcggtaacagaagtgccgcgtgaacagacaaaccgttacggtattctggac
acaggcaaggatgatggccgccttgtggaagtaaaaggcctggttgaaaagccaaagccg
gaagatgcaccttccaatctgtccatcattggccgttatgtgctgacaccagaagttatg
ccttacctttccaagctggaaaaaggtgcaggtggtgaagtgcagcttacagatgccatg
gcaaaaaccattggtcaggtgcctttccacggcctgcgttatgaaggcacccgctatgat
tgcggcaacaagcttggcttccttgaagcgcaggtagcctttgctctggaacgtcctgat
cttgctgatggcgtgaaggaatttctgaaaaagtacacagataaaatctga

DBGET integrated database retrieval system