KEGG   Amphimedon queenslandica (sponge): 100640574Help
Entry
100640574         CDS       T02284                                 

Definition
ubiquitin carboxyl-terminal hydrolase 32-like
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
aqu  Amphimedon queenslandica (sponge)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1159 aa AA seqDB search
MGNTQFGFFGYMNRFKKSGRSKGQLVYLMSTQWFNSWRIYTQFEMDDCPLSSLIPPAEQS
SKNTDRGDRGTTPVAEPEIVDVTVEGEDVAEGYTHIVTPETSSSGSAQKRGGVQSHPQED
EDPLKPIGISNSHLCLEEPFPGSKKLISLTNEGGVLKPSLKEYVDYYLLPEDVWRALVTW
YGTAGLGGGPPLPRPVINEEGVVSLYPTLLKVFRHTTLPPAKQSKSTGPWNSMLEVFSFF
GFRSGGGADNSATPVGNTPLPGDATQPLLPRRILYYSAAFYDNNTLQEMVEVMQKVLHAK
PDEVRIYSLSDDEEQLELLDEEEKTVEDLGFKNGQKILVETRNKDNSWPEELVAAIKEVQ
AKDSNEKQVVKSQGTKVPEGATGLSNLGNTCFMNSSLQCISNLQPLTTYFKEKDYLLEIN
KQNPLGMKGVMAKRYGELVSDLWTGHSKSITPWRFRYTIAQNAPQFNNFQQQDAQELLSF
VLDGLHEDLNRVKVKPYRELPDSDDRPIAEVADEAWSYHRERNNSIIVDLFQGQLKSLVE
CTVCSYKSIKFDPFTFLSLPLPLESSTSLEIIVIPIDGSQPTRYCLKLELDAKYRLLKEQ
LVEMCQINRLILVDVYGGTVRSFPNDDQKMRTVLSGSLYAYEIPPHYRRITPSREEEQPL
ERTETNDEGEESINKGEESTSKEEAEAPTEVETTKEEIEQETKTPTEEVESSAKGAESDT
PTTNKVENGEIGGSLRLDNYFVSTQKNRPILFSYPMVLPCAPTTPHSALYKEIWNQVQRL
IIPDPPNTDEFCRGCPIECDEGTFGADDPPHYIAIDWEDGFIHLKYQSGLERPKDHESMD
IMKNTDSQPIELSECLAAFSKPEELGEDELWYCKKCETHRPARKTLEVWKLPPVLIIHLK
RFHFHNGRWIKSQQRVRFPMSGLDPYAYSDSELFNNNEFIQTGIEGEELNGEVGGDSVTP
PLTGEGEESAPLGVSVEVNDERKEEEEEEEGEGEKNDKELLVVASDEDQNENELTENEIQ
ESDEIKAGVPKLRDIKRNFSRTTSVYMSSRPIYDLFAITVHSGILGGGHYTSFAKNPNSN
WYYYNDSSCKETTEDKVSSESPYMLFYEVRDLREHVDEYRVGGARSPPLSPVNDNDEGIL
QGEGGRGKSSGGRGKCRQQ
NT seq 3480 nt NT seq  +upstreamnt  +downstreamnt
atggggaatacccagtttggtttctttggctacatgaacagattcaagaagagcggaagg
tcaaaaggtcagttagtgtatctgatgtcaacccaatggttcaacagctggaggatatac
actcaatttgagatggatgattgtcctctctcttcgttgataccacctgctgaacaatct
tcaaagaacacagacagaggagatagaggcactactcctgtagctgaacctgaaattgtt
gatgttacagttgaaggtgaagatgttgctgaaggatatactcatattgttacacctgaa
actagcagctctggttcagctcagaaaaggggcggagtccagtcacacccacaagaggac
gaggaccctttgaagccaattgggataagcaactctcacctgtgtcttgaagaacctttc
cctggcagcaagaagttgatttcattaactaatgaaggaggagtcttaaagccctcatta
aaggaatatgttgattattatttattgcctgaggacgtctggcgggcactggtcacctgg
tatgggacagctggactgggaggaggaccacccctgcctagaccagttattaatgaagag
ggtgtggtctcactctaccccactctattaaaggttttcagacacacgactcttccacct
gctaaacagtcaaagtccaccggcccttggaactcaatgcttgaagtgtttagcttcttt
gggtttaggtcagggggtggggctgataattcagccacgcctgttggaaacacaccatta
cctggtgatgctactcaacctttactgccgagaagaatcctctactatagtgcagccttt
tatgataataacacactgcaggagatggttgaggtgatgcaaaaagtgctacatgccaaa
ccagacgaagtacgtatctacagtttaagtgacgatgaggagcagctggaactactggat
gaagaagagaagacagtagaggatctggggtttaaaaatggacagaaaatactagtagaa
actcgtaacaaagacaactcgtggcctgaagagctagtggcggccattaaagaagttcaa
gcaaaagattcaaacgaaaaacaagttgtgaaatcccaagggaccaaggttccagagggg
gccactgggctcagtaaccttggcaatacctgcttcatgaattcatctcttcagtgtatc
agtaacttacagccactgacgacctattttaaagagaaggactatctactggaaattaac
aagcagaacccattaggaatgaaaggtgtgatggccaagagatacggagagcttgtctct
gacctttggactggacacagcaagagtataacgccatggagatttagatacactattgct
caaaacgctcctcaatttaataacttccagcaacaagacgcccaagaacttttatcattt
gtattagatggacttcacgaggatctaaacagagtaaaagtgaagccatacagagaatta
ccggacagtgacgaccgaccaatcgctgaagttgctgatgaagcgtggtcttatcacagg
gagagaaacaattcaataatagtcgatttatttcaaggacaactaaagtccctagttgaa
tgtacagtctgttcttataaaagtatcaaatttgatccattcactttcctgtccttgcca
ctcccactggagagctcaactagtttagaaattattgtgatacccattgatggatcccag
ccaactcgctattgtctaaagttagaacttgatgctaaatatagattactaaaggagcag
ctggttgaaatgtgtcaaataaatcgtctcattttggttgatgtctacggagggacagtc
aggagttttccgaatgatgatcagaagatgaggactgtcctgagtgggtcactgtacgcg
tatgaaataccacctcactacaggagaatcacaccatccagagaagaggaacaacctcta
gagagaacagaaaccaatgatgagggggaggagtcaattaataaaggggaggagtcaact
agtaaagaagaagcagaggctcctactgaagtagagacgactaaagaagagattgaacaa
gaaacaaagactcctactgaagaggtggagtcatctgctaaaggggcggagtcagacaca
cccactactaataaagttgaaaatggtgagattggaggatctttaagattagacaattat
tttgtatcaactcaaaagaatcgtccgatcctcttcagttacccaatggtactgccctgt
gcaccaacgacacctcactccgccctctacaaggaaatatggaaccaagttcaacgacta
ataataccagaccccccaaacactgacgaattctgtcgcggttgccctatagaatgtgac
gagggtacttttggagctgatgatcctccacactatattgcaatagactgggaagatgga
ttcattcatctgaagtaccagtccgggctggagaggcccaaggatcatgaaagcatggac
atcatgaagaacactgactcgcagccaatagaactctcagagtgtctcgctgcattctct
aaacctgaagaactaggagaggacgagttatggtattgtaagaagtgtgagacccatagg
ccggctaggaagacacttgaagtttggaagttgccacctgttctgataattcatttgaaa
aggtttcattttcacaatggccgctggattaagtcccaacagagggtcaggttccctatg
agcggattagatccttatgcctactcagactcggaactgttcaacaataatgagttcata
cagactggcattgagggggaggagcttaatggggaggtgggaggggattcagtaaccccg
ccccttacaggagaaggggaggagtcagcacctcttggggtgtcagttgaagttaatgac
gagagaaaagaagaggaggaggaggaggaaggagagggagagaaaaatgacaaagaattg
ttagtggtcgccagtgatgaagatcagaatgagaatgaactcactgagaatgaaatacag
gaatcagatgagatcaaagctggtgtcccaaagttaagagacattaagagaaacttctct
cgtactacgagtgtctacatgagctctagacctatttatgatctctttgctatcactgtc
cacagtggtattttaggtggtggacattacacgtcttttgccaaaaacccaaactcaaac
tggtattattataacgacagctcatgcaaggaaactacagaagacaaggtttcgtctgag
tctccttacatgttattttatgaagtgagggacctacgggaacatgtagacgagtataga
gtaggcggagccaggagtccaccattgtccccggttaatgataatgatgagggtatcctt
caaggtgagggtgggcggggcaaatctagtggtgggcgtggaaagtgtagacagcagtga

DBGET integrated database retrieval system