KEGG   Agrobacterium radiobacter: Arad_8269Help
Entry
Arad_8269         CDS       T00850                                 

Gene name
argE
Definition
(RefSeq) acetylornithine deacetylase
  KO
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ara  Agrobacterium radiobacter
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arad_8269 (argE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    Arad_8269 (argE)
Enzymes [BR:ara01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Arad_8269 (argE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1114511..1115734)
Genome map
AA seq 407 aa AA seqDB search
MIAIDTSFPPGLGYPAFSDLMEELLAPLGFYTRRVTVPDALWRVANGPACGERVNLIAER
PANKPVCGLYYHVDTVPAAPGWQRNPLGLTREEDQLFGLGAADMKGTIAATLLALRAAEE
HGVELAYDPMLLLCTDEEGGLYPGIRYLAEQNMLKGHIVNFNGSAAPRIWAGCFGVFHLQ
ITIRGHAVHAGEGNRTGSGVNAIEGALPLLNALQALKPKIAAFESKLPPPPHASGPLRPQ
LSISAVNGGTSGGQVAAEVNILVSRRYAPEESYDAARATLEDLVRACVAQTPGLSFDIDV
VGHLIPTADPDGPHWPRWQKALSLGFGYQPSDFSKWGAASCSDFGYVQRTGVMQEILLGG
LGRPESCIHSPEEHTTTTDIIALAKSILAYLAQDFSADLIPDYSASK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgattgccatcgacacctcctttccaccgggcttgggctaccctgccttttcggacctg
atggaagaactgctggcacccctgggcttttacaccaggcgcgtcacggtgccggacgcg
ctatggcgtgtcgccaacggcccggcttgcggagagcgcgtcaatctgatcgccgaacgt
ccggcaaacaagccggtctgcggcctctactatcatgtcgataccgttcccgcagcgccg
ggctggcagcgtaacccactgggcctgacgcgcgaggaagaccagcttttcgggctgggc
gccgccgacatgaaggggacgatcgccgcgacattgcttgcgctgcgcgctgccgaagag
catggcgtcgagcttgcctatgatcccatgctgctgctgtgcacggatgaggaaggcggg
ctttatcccggtatccgctatcttgccgaacaaaacatgctcaaggggcacatcgtcaat
ttcaacggttcggccgcgccgcgcatctgggccggctgcttcggtgtctttcaccttcag
atcaccatcagagggcatgccgttcatgccggcgaaggcaatcgcaccggttcgggcgtc
aatgccatcgagggtgccctcccccttctcaatgcactccaggcgctgaagccgaagatc
gccgctttcgagtccaaactgccgccgccaccacatgcgagcggcccattgcggccgcag
ctgtccatatccgccgtcaacggcggcacgtcgggcgggcaggtcgcggccgaggtcaat
atcctcgtcagccgccgttacgctccggaagaaagctatgatgcggcgcgcgccacactc
gaggatctggtgcgcgcatgcgtggcgcaaacgccaggccttagcttcgacatcgacgtc
gtcggccacctgatcccaacggcagaccccgatggcccccattggccgcgctggcagaag
gctttgagcctcggtttcggctaccagccctccgacttcagcaagtggggggccgcgagc
tgctcggatttcggttacgtccaacggaccggcgtgatgcaggagatactgctcgggggc
ctcggacgtcccgaaagctgcatccacagcccggaagaacacacgacaacgacggatatc
atcgccctggcgaaaagcattctcgcctacctcgcgcaggatttttccgccgatctcatt
ccagactattccgcgtcaaaataa

DBGET integrated database retrieval system