KEGG   Acinetobacter schindleri: AsACE_CH01679Help
Entry
AsACE_CH01679     CDS       T04787                                 

Gene name
fadI-1
Definition
(GenBank) acetyl-CoA C-acetyltransferase 1
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
asj  Acinetobacter schindleri
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:asj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AsACE_CH01679 (fadI-1)
   00630 Glyoxylate and dicarboxylate metabolism
    AsACE_CH01679 (fadI-1)
   00640 Propanoate metabolism
    AsACE_CH01679 (fadI-1)
   00650 Butanoate metabolism
    AsACE_CH01679 (fadI-1)
  Lipid metabolism
   00071 Fatty acid degradation
    AsACE_CH01679 (fadI-1)
   00072 Synthesis and degradation of ketone bodies
    AsACE_CH01679 (fadI-1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AsACE_CH01679 (fadI-1)
   00310 Lysine degradation
    AsACE_CH01679 (fadI-1)
   00380 Tryptophan metabolism
    AsACE_CH01679 (fadI-1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AsACE_CH01679 (fadI-1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AsACE_CH01679 (fadI-1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AsACE_CH01679 (fadI-1)
Enzymes [BR:asj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AsACE_CH01679 (fadI-1)
Exosome [BR:asj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AsACE_CH01679 (fadI-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1764353..1765867
Genome map
AA seq 504 aa AA seqDB search
MSKTTQENPAVENPVAESVSKPSTARKRTSKTTSATSAEKSPTKTTRPRAASNRAENTTS
SNKTLTPKTQISVQQDQNMSQNTVRRVAIIGGNRIPFARSNGAYFTASNTDMFTAALNGL
IERFNLQGQRLGEVVAGAVLKHSRDFNMTRECVLNTVLAPETPAYDIQQACGTGLQAAFL
VANKIALGQIEVGVAGGVDTTSDAPIAFGDGLRKALLELNIARTAKDRLKALTKINVKDL
MDAPKNGEPRTGLSMGDHQAITTLEWGISREAQDELAASSHQKMAAAYEEGFFDDLITPF
LGLERDNNLRPDSSVEKLAKLKPAFGKGDARTMTAGNSTPLTDGASCVLLASEEWAKANG
HEVLAYLTFQETAAVDFVEKKEGLLMAPAYAVPRMLERAGLKLQDFDYYEIHEAFASQVL
STLKAWEDPKFCKERLGLDAPLGSIDRAKLNVKGSSLAAGHPFAATGGRIIATAAKLLNQ
KGSGRVLVSICAAGGQGVTAIIEK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacaactcaagaaaatccagcggtcgagaatcctgtagccgaaagcgtgtca
aaaccatcaacagcacgcaagcgcacaagcaaaacgacgagcgcaacgtctgcagaaaaa
agtccgacgaaaaccacgcgcccccgtgctgcgtctaatcgtgcggaaaatacgacttca
agcaataaaaccttaacaccaaaaacacagatttctgttcaacaggaccaaaacatgagc
caaaatacagttcgccgcgttgctattatcggtggtaaccgcattccatttgcacgttct
aacggtgcttactttacggcatccaatactgatatgttcaccgcagccctgaatggcctg
attgaacgttttaatttacaaggtcaacgcctgggtgaagtcgtagctggtgcagtattg
aaacacagccgtgactttaacatgacgcgtgagtgcgtactgaacactgtccttgcacct
gaaactccggcttatgacattcagcaggcatgtggtactggtctgcaagctgcattcctg
gttgccaataaaattgcattaggtcaaatcgaagtcggtgtggctggtggtgtagatact
acctctgacgcgccaatcgcatttggtgatggtttacgtaaagctttacttgaactgaac
attgctagaacagcaaaagatcgtttgaaagctttaaccaaaattaatgtgaaagacctg
atggatgcaccgaaaaatggtgagccacgtaccggcctgtctatgggcgaccatcaggca
atcacaacactggaatggggcatttctcgtgaagcacaggatgaactggctgcatcttca
caccagaaaatggcagcagcatacgaagaaggtttctttgatgacctgatcacaccattc
ctaggtcttgagcgtgacaataacctgcgtccagattcttcagttgaaaaactggcaaaa
ttgaaacctgcttttggtaagggcgatgcacgtaccatgactgcaggtaactctactccg
ctgacggatggcgcatcttgtgtactgctagcgtctgaagaatgggcgaaagccaatggt
catgaagtactggcttacttaactttccaggaaactgcggcagttgattttgtagagaag
aaagaaggcctgttgatggcacctgcttatgccgttccacgtatgctggagcgtgctggt
ctgaaacttcaagacttcgactactatgaaatccacgaagcatttgcatcgcaagtactt
tcaaccttaaaagcgtgggaagatccgaaattctgtaaagagcgtttaggtctagatgca
ccattgggttcaatcgaccgtgccaaattgaatgtaaaaggctcttcactggcagcgggc
cacccatttgctgcgacaggtggccgtatcatcgcgactgctgcgaaactattaaaccag
aaaggttcaggtcgtgtactggtgtcaatctgtgcggctggtggtcaaggtgtgactgcg
attattgaaaaataa

DBGET integrated database retrieval system