KEGG   Aequorivita sublithincola: Aeqsu_2596Help
Entry
Aeqsu_2596        CDS       T02132                                 

Definition
fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
asl  Aequorivita sublithincola
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Aeqsu_2596
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Aeqsu_2596
Enzymes [BR:asl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Aeqsu_2596
Lipid biosynthesis proteins [BR:asl01004]
 Desaturase
  First
   Aeqsu_2596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2794749..2795504
Genome map
AA seq 251 aa AA seqDB search
MTILIFIVILWYGGLFFQTFFLHRYAAHQSFTMSKITEKITFVLTWFFQGSNYLSAYGYG
VMHRMHHAYADTEDDPHSPKYDASVFSMMWRTKNIYADINQKRIEVDEKFTKNVPQWQRF
DNFASSSFSRISWGLLYFAFFLYFATAWWQWLFFPVALFMAPIHGVIINWYAHIYGYVNF
KSKDTSKNLLPFDFLMMGEGYHNNHHKHASRANFGGVRWHELDITYKIMQVLHAFRIIKL
KPITQVVRRDV
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgacaattttaatatttatagtgatactttggtatggaggtttgttctttcagactttt
ttcttgcatcgctatgccgcacaccaatcctttacaatgtccaaaataactgaaaaaatc
acctttgtactaacgtggttttttcaaggatcaaactatttaagcgcctatggttatggg
gttatgcacagaatgcaccatgcctatgccgatacagaagacgatccgcattctccaaaa
tatgacgctagcgttttttcaatgatgtggcgaaccaaaaatatttatgcagatataaac
cagaaacgcattgaagtagatgaaaaattcactaaaaacgtaccgcaatggcagcgtttt
gataattttgccagttcttctttttcaagaattagttggggtcttttgtactttgccttt
ttcctttatttcgcaacggcttggtggcaatggttattttttccagttgcattatttatg
gcaccaatccacggagtaatcataaattggtacgctcatatttatggatatgtaaatttt
aagtccaaagacacttcaaaaaacttattgccttttgattttttaatgatgggcgaggga
tatcataacaatcaccataaacacgcaagccgagctaactttggtggtgttcgttggcac
gagttggatattacttataaaataatgcaggtattgcacgcattcagaataattaaatta
aagcccattacacaagttgtgcgtagggatgtttaa

DBGET integrated database retrieval system