KEGG   Alligator sinensis (Chinese alligator): 102379700Help
Entry
102379700         CDS       T02922                                 

Definition
acetylcholinesterase-like
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    102379700
Enzymes [BR:asn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     102379700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 772 aa AA seqDB search
MIPNAGAFLPFLLLILPATPQEPEGATAELVAQTQAGPVRGLRLPALSGHVTAFLGIPYA
EPPLGPLRFRPPRPLRRPWRGTRDASAYPQACWQYVDKLYPGFPGLEMWNPNRELSEDCL
YLNVWVPSPRPRNASVLVWIYGGGFYSGSSSLDVYDGRYLAQAEGLVLVSMNYRVGALGF
LALLGSPEAPGNVGLLDQRLALQWVQSNIRAFGGDPSAITLFGESAGAASVGMHLLSPAS
RALFHRAVLQSGAPNGPWATISPGESRRRALELAHRVGCPAGGNDSEVVACLRSRSPQDL
IDQEWGVLPQPSVFRFPFVPVVDGDFLADSPEVLLNAGSFAEMPVLAGVVHDEGSYFLIY
GAPGFSKDNESLITREEFLGGVRLGVPQAGELAAEAVVLQYTDWRDPEDPVKNREALDDV
VGDHNVVCPVTLFAQRAAERGAPVFAYLFDHRASTLAWPAWMGVPHGYEIEFVFGLPLQP
ALNYTASEAALSHRMMRYWGNFARTGDPNDASGQAGHWPPYTATGQRYVRLDTGPLAVGQ
GLRAQLCAFWTRFLPKLLNVTASIPASTAAAPPASPLSWGHLPAMLPLLLLLLAGPGGAW
GGRDPNSVLEVENGGPWGDWGHKEFCPRGTYASAFTLKVQPHQGWSHFGDDTGLNGVRLI
CTDGSSVLSSEGKWGLWQSPRGCGGGTLVQFRLRAEPPRGPFRDDEAATDVSMLCSNGRE
VAGEGSTSGDWGNWSRPCAFGAVCGLQTRVELPGGPGQDDTGLNDLRLFCCN
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgatccccaacgccggtgccttcctccccttcctcctcctcatcctgccagccaccccc
caggagccagagggggccacggcagagctggtggctcagacacaggcagggccggtgcgg
gggctgcgcctgcccgcgctgtctggccacgtcaccgccttcctgggcatcccctatgcc
gagcccccacttggccccttgcgcttccggcccccgcggcccctccggcggccatggcgc
ggcacgcgagacgccagcgcctacccccaggcctgctggcagtacgtggacaagctgtac
cccggcttccctggcctggagatgtggaaccccaaccgggagctgagcgaggactgcctg
tacctgaatgtctgggtgccgtcaccacggccccgcaacgcctcggtgctggtctggatc
tacggcggcggcttctacagtggctcatcctcactggacgtctatgatgggcggtatctg
gcacaggctgaagggctggtgctggtgtccatgaactaccgtgtgggtgccttgggcttc
ctggcactgctgggcagccctgaggccccgggcaatgtagggctgctggaccagcgcttg
gccctacagtgggtgcaatccaacatccgcgccttcggcggggaccctagtgctatcaca
ctcttcggggaaagtgctggagctgcctcggtgggcatgcacctgctgtcaccagctagc
cgggccctgttccaccgcgctgtgctgcagagtggggcccccaatgggccctgggccacc
atcagccctggggagagccggcggcgggcactggaactggcgcaccgcgtggggtgtcca
gccgggggcaatgactctgaggtggtggcctgtctccggtcccggtcaccccaggacctc
atcgaccaggagtggggggtcctgccgcagcccagcgtctttcgcttccccttcgtgcca
gtggtggatggggatttcctagccgacagccccgaggtgctgctcaacgcaggcagcttc
gccgagatgccagtgctggccggggtggtgcacgatgaaggcagctacttcctgatctat
ggggcaccagggttcagcaaggacaatgagagccttatcacccgtgaagagttcctgggg
ggggtgcggctgggggtcccgcaggctggggagctggcggccgaggcggtggtgctccag
tacacggactggcgggaccccgaggacccagtgaagaaccgggaggcactggacgatgtg
gtgggtgaccacaacgtggtgtgtcctgtcactctgttcgcgcagcgggcggccgagcga
ggagccccggtcttcgcctacctcttcgaccaccgcgcgtccacgctggcctggccagcc
tggatgggcgtccctcacggctatgagattgagttcgtctttgggctgcccctgcagcca
gcgctcaactacacagcaagcgaggccgccctcagccaccgcatgatgcgctactggggg
aactttgcccgcactggggaccccaacgatgcatcgggacaggccgggcactggccccca
tacacggccacggggcagcgctatgtgaggctcgacacggggcccctggccgtagggcaa
ggcctgcgcgcacagctctgcgccttctggacccgcttcttgcccaaactgctcaatgtc
accgcctccatcccagcatccaccgccgccgccccccccgcttctcctctttcttggggg
catctcccagccatgctgcctctgctgctgctcctgctcgccggccccgggggagcctgg
gggggccgggaccccaacagcgtcctggaggtggagaacgggggaccctggggggactgg
gggcacaaggagttctgcccccggggcacctacgccagcgccttcaccctcaaggtgcag
ccccaccagggctggagtcacttcggcgacgacacagggctcaacggcgtccggttgatc
tgcaccgacggcagcagcgtcctgtccagcgagggcaagtggggcttgtggcagtcgccc
cgcggctgcggcggggggactttggtgcagtttcggctccgggctgagcccccccgcggc
cccttccgtgacgacgaggcggccacagacgtgtccatgctctgctccaacgggcgggag
gtcgcgggcgagggcagcacaagcggggactggggcaactggagccggccctgtgccttt
ggggccgtgtgtgggctgcagacacgagtagagctgccgggggggcctggccaggatgac
accggcctcaacgacctgcgcctcttctgctgcaactga

DBGET integrated database retrieval system