KEGG   Caldicellulosiruptor bescii: Athe_2183Help
Entry
Athe_2183         CDS       T00857                                 

Definition
hypothetical protein
Orthology
K14415  
tRNA-splicing ligase RtcB [EC:6.5.1.3]
Organism
ate  Caldicellulosiruptor bescii
Brite
Enzymes [BR:ate01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.3  RNA ligase (ATP)
     Athe_2183
Transfer RNA biogenesis [BR:ate03016]
 Eukaryotic Type
  tRNA spricing factors
   tRNA splicing ligase
    Athe_2183
 Prokaryotic Type
    Athe_2183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2312099..2313454)
Genome map
AA seq 451 aa AA seqDB search
MKKIRDGVYTNDYAIFFMTEEILKDLDEGVLQQAKNASQIPNVEFLGYTPDAHIGKGTSI
GTIIVWDMSKAWISPTIVGVDIGCGMRLILTDKFADDIDKALLKKIMDEVEDLIPTGVGK
KNKKIALSKTKYEEYLQNTEIDKDISDKMVLIHEFDLDTIPDEAHEIGKEQFATLGGGNH
FIEFQKLHVIDKIIAEKWGLFDGQFVVMIHSGSRRFGAVIGDYYQKKFKDVMKSKGITTP
DPQLTFLPIDNKVAKDYIKAMQSAAIYAKINRHYMSNFIISVLEKHSIDAWVLYDVAHNI
AYMERFANREKLVIRKGATRALPPNHYLIPNPKFAETGHPVILPGSMGSSSYLMRGIEDN
IISYHTVNHGAGRVLSRTKAKKTISIEEFSKALKQGQSGEILINTKNLKDFLDESPQSYK
DIELVINSVITSRLATPVAKMEPLGVIKGKD
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagataagagacggtgtttatacaaacgattatgccatattcttcatgacagaa
gaaattttaaaggaccttgacgaaggggtgctccagcaggcaaaaaacgcatcccaaatt
ccaaatgtagaatttttgggctatacaccagatgcacacataggcaaaggtacttcaatt
ggcacaataatcgtttgggacatgtcaaaggcgtggatttcaccaacaattgttggtgtt
gacataggttgtggtatgagactgattctgacagacaagtttgcagatgatatagataaa
gcacttttgaagaaaataatggatgaggtagaagatttgattccaacaggtgttggtaag
aaaaacaaaaagatagctctttccaagacaaagtatgaagagtatcttcaaaatacagag
attgataaggacatttcagacaagatggttctcattcatgagtttgaccttgacacaata
ccggatgaggctcatgagattggtaaagagcaatttgcaaccttgggtggaggcaaccac
tttatagagtttcaaaaacttcatgtcatagataaaattattgcagaaaaatggggactt
ttcgatgggcagtttgttgtgatgatacattctggttcgagaaggtttggagcggtcatt
ggcgattattatcaaaagaaatttaaagacgttatgaaatccaagggtatcactacgcca
gacccgcagcttacctttttgccaattgacaacaaggttgcaaaagattatattaaagct
atgcagtcagcagctatttatgcaaaaataaatagacattatatgagcaactttataata
tcagtcttagaaaaacactcaattgacgcttgggttttatatgacgttgcacataacatt
gcatacatggaaagatttgcaaacagagaaaagcttgttataagaaaaggggcaacaaga
gcattaccgccaaaccactatttgattccgaatcctaaatttgctgagacaggacatcct
gtgattttacctggcagtatgggttcaagttcatatcttatgaggggaattgaggacaat
ataataagttatcatacagtcaaccatggagcaggcagggttttatcacgaacaaaggca
aaaaagacaatttccattgaagaattttcaaaagctttaaaacaggggcaaagcggagag
attcttataaacactaaaaacctaaaagattttttagatgaaagtccacagagttataaa
gacattgaacttgtgataaattcagtaattacatccaggcttgctactcctgttgccaaa
atggagccgcttggggtcataaaaggaaaagattaa

DBGET integrated database retrieval system