KEGG   Arabidopsis thaliana (thale cress): AT2G11810Help
Entry
AT2G11810         CDS       T00041                                 

Gene name
MGDC
Definition
Monogalactosyldiacylglycerol synthase 3
Orthology
K03715  
1,2-diacylglycerol 3-beta-galactosyltransferase [EC:2.4.1.46]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AT2G11810 (MGDC)
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.46  monogalactosyldiacylglycerol synthase
     AT2G11810 (MGDC)
Glycosyltransferases [BR:ath01003]
 Glycolipid biosynthesis
  Glycoglycerolipid
   AT2G11810 (MGDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 362 aa AA seqDB search
MMKVVSPRTRSDSITEKVFRRVYSNFNISTVEDEYIHRQRSSDYEKESRLRKRGLEDKEE
VMEMEQMGAERIKTVLILMSDTGGGHRASAEAIRDAFKIEFGDDYRIIIKDVWKEYTGWP
LNDMERQYKFMVKHVGLWSVAFHGTSPKWIHKSYLSALAAYYAKEIEAGLMEYKPDIIIS
VHPLMQHIPLWVMKWQGLHKKVIFVTVITDLNTCHRTWFHHGVSRCYCPSKEVAKRALVD
GLDDSQIRVFGLPVRPSFPRTILNKNELRKELEIDLNLPAVLLMGGGEGMGPVQKTALAL
GDSLYNSKESNPIGQLIVICGRNKVLASTLASHEWKIPVKVRGFETQMEKWMGACDCIIT
KH
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagtggtgtcacctcgtacacggtcggattcaatcactgagaaggtgtttcga
cgagtctatagcaattttaacatctcaacagtagaagatgagtatatccatcgtcagaga
tcaagtgattatgagaaggagagtcgtctaaggaagagagggttagaagacaaagaagaa
gttatggagatggagcagatgggagcagagaggatcaaaactgttcttattctcatgagt
gataccggcggtggccaccgtgcttcagccgaggccatccgcgacgctttcaagatcgaa
ttcggagatgactatcggataatcataaaagatgtttggaaagaatacactggatggcca
ttgaacgacatggagagacagtacaagttcatggtgaaacatgttggtctttggtctgtt
gcgtttcatggtacttctcccaaatggatccacaaaagctatctaagtgctcttgccgct
tattatgccaaagaaatagaggccggtttaatggagtacaaaccggacattattattagc
gtgcatcctctgatgcaacacataccattgtgggtaatgaaatggcaaggacttcacaag
aaagttattttcgttacggtcatcactgatctaaacacttgccaccgtacatggttccat
catggagtcagcagatgttattgtccgtccaaagaggttgcaaagagagcattagtagac
ggccttgatgactctcaaatccgtgtctttggcttacctgtccgcccatctttccctcgc
actattctcaacaagaatgaactaaggaaggaacttgaaatagacttaaatttacctgcg
gttctattaatgggagggggtgaaggaatgggtccggttcaaaaaacagctctagccctt
ggagattctttatacaactctaaagaaagtaatccaataggacaattgattgtcatatgc
ggccggaacaaagtccttgcttctacattagcatctcatgaatggaagattccggtcaag
gttcgagggtttgaaacacaaatggaaaaatggatgggagcttgtgattgtatcatcact
aagcactaa

DBGET integrated database retrieval system