KEGG   Arabidopsis thaliana (thale cress): AT1G32060Help
Entry
AT1G32060         CDS       T00041                                 

Gene name
PRK
Definition
(RefSeq) phosphoribulokinase
  KO
K00855  
phosphoribulokinase [EC:2.7.1.19]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT1G32060 (PRK)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AT1G32060 (PRK)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.19  phosphoribulokinase
     AT1G32060 (PRK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 395 aa AA seqDB search
MAVSTIYSTQALNSTHFLTSSSSSKQVFLYRRQPQTNRRFNTLITCAQETIVIGLAADSG
CGKSTFMRRLTSVFGGAAKPPKGGNPDSNTLISDTTTVICLDDYHSLDRYGRKEQKVTAL
DPRANDFDLMYEQVKALKNGIAVEKPIYNHVTGLLDPPELIQPPKILVIEGLHPMFDERV
RDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAFIDPQKQYADA
VIEVLPTTLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTISWIPCGRKLTCSYPGI
KFNYEPDSYFDHEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQMLKHADFPGS
NNGTGLFQTIVGLKIRDLYEQLIANKATARAEAKA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctgtctcaactatctactcaacacaagctctcaattcaactcatttcttaacctct
tcttcctcctccaaacaagtcttcctctaccgtcgtcaaccacaaaccaaccgtagattc
aacacactcatcacttgcgcacaagaaaccatcgtgatcggactagctgctgactctggc
tgcggcaaaagtacctttatgcggaggctcaccagcgtctttggtggcgctgctaagcca
ccaaaaggcgggaaccctgattccaacacactcatcagcgacacgaccactgtgatctgt
cttgatgattaccattctttggataggtacggtaggaaagagcagaaagtcaccgctttg
gacccacgcgccaatgactttgatctcatgtatgagcaagtcaaagctcttaagaatggt
atagccgtcgagaaaccgatttataaccatgtcactggacttcttgaccctccggagctt
attcagcctcctaagattcttgtcatcgaaggtcttcacccaatgtttgatgagcgagta
agagacttactagacttcagtatctacttggacattagcaacgaagtcaaattcgcttgg
aaaattcagagggacatggctgaaagaggtcacagtttggagagcatcaaagcgagtatc
gaagcccgaaagcccgacttcgatgcattcatcgacccgcaaaagcagtacgcggatgcg
gtcatagaagtgcttcctacgactctgatcccagatgacaacgaagggaaagtgttgaga
gtgagattgataatgaaggaaggtgttaagtacttcagcccggtttacctgttcgatgaa
ggttcaaccatctcgtggattccttgcggccgcaaactcacttgctcgtaccctggcatc
aagttcaactacgaacctgactcctacttcgaccatgaggtatcagttttggagatggat
ggacaatttgatagactggacgagctgatttacgtggaaagtcacttgagcaacctctcg
accaaattctacggagaagtcactcaacaaatgctcaaacatgctgatttcccgggtagc
aacaacggtactggtcttttccaaaccattgttggattgaagatcagagatctctatgag
cagctcattgccaacaaagccactgctcgtgcagaagctaaagcctaa

DBGET integrated database retrieval system