KEGG   Arabidopsis thaliana (thale cress): AT1G52500Help
Entry
AT1G52500         CDS       T00041                                 

Gene name
MMH-1
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    AT1G52500 (MMH-1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     AT1G52500 (MMH-1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     AT1G52500 (MMH-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
1
AA seq 390 aa AA seqDB search
MPELPEVEAARRAIEENCLGKKIKRVIIADDNKVIHGISPSDFQTSILGKTIISARRKGK
NLWLELDSPPFPSFQFGMAGAIYIKGVAVTKYKRSAVKDSEEWPSKYSKFFVELDDGLEL
SFTDKRRFAKVRLLANPTSVSPISELGPDALLEPMTVDEFAESLAKKKITIKPLLLDQGY
ISGIGNWIADEVLYQARIHPLQTASSLSKEQCEALHTSIKEVIEKAVEVDADSSQFPSYW
IFHNREKKPGKAFVDGKKIDFITAGGRTTAYVPELQKLYGKDAEKAAKVRPAKRGVKPKE
DDGDGEEDEQETEKEDESAKSKKGQKPRGGRGKKPASKTKTEESDDDGDDSEAEEEVVKP
KGRGTKPAIKRKSEEKATSQAGKKPKGRKS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgccggagcttccagaggtcgaggcggcgaggagagcaatagaagaaaattgtcttgga
aaaaagattaagcgagtcattatcgccgacgacaacaaagtgatccatggaatctcgccg
tccgatttccagacctcaatcctcggaaaaaccatcatctctgctcgtagaaagggcaaa
aacctctggctcgaattagattccccgccatttccttcttttcaattcggtatggctggt
gctatttatatcaaaggcgttgcagttactaagtataagaggtctgctgtaaaggactca
gaggagtggccatctaagtattcaaagttcttcgtcgagcttgatgatggtctggagctt
tcatttactgataagaggagatttgccaaagttcgacttctagcaaatcctacttctgtg
agtccaatatcagagcttggtcctgatgcattgttggagcctatgacagttgatgaattt
gcagaaagcttagctaaaaagaaaataaccataaaacctctcctacttgatcagggatat
atttcaggtattgggaattggatcgctgatgaagtgctgtaccaagccagaatccacccg
ttgcagactgcttctagcctctccaaagagcaatgtgaagctttgcacacatccatcaaa
gaggtgatagaaaaagctgtggaagttgatgcagacagtagtcagtttcctagttactgg
atttttcataatagggaaaagaagccaggaaaggcctttgttgatgggaagaagattgat
ttcattactgctggtggaaggacaacagcttatgttccagaactgcagaaactttatggg
aaagacgcagagaaagcagccaaggttagaccggctaaacgaggtgtgaaacccaaagaa
gacgatggagatggggaagaagatgaacaagaaactgagaaagaagatgagagtgctaaa
tcgaagaaaggacagaaacccagaggtggtcgtggtaagaagcctgcatcgaagacaaaa
acagaagagagcgacgatgatggagatgatagcgaggctgaagaagaagttgtgaaaccc
aaaggccgtggtacaaagcctgcaataaagaggaagtctgaagagaaagctactagccaa
gctggtaagaagccaaaaggaagaaaaagttga

DBGET integrated database retrieval system