KEGG   Arabidopsis thaliana (thale cress): AT1G55970Help
Entry
AT1G55970         CDS       T00041                                 

Gene name
HAC4
Definition
(RefSeq) histone acetyltransferase of the CBP family 4
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AT1G55970 (HAC4)
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    AT1G55970 (HAC4)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    AT1G55970 (HAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 1456 aa AA seqDB search
MNNNKEVPQNSVAVSSSSSAPITVISPQQDANNFIKKRRTALRNRIYAIVRHKQKQHQIF
LDKKNQQQQQRVDDATQRALLEKQDQQCIAATRMIEEELLKSSRSFEEYFDLRTFDARVR
TILQQLGTMLSQRRAAAAAMNNGEAQCITSTRAVHTSISVSNSFQCGRSLVPINCTTATA
GAFSIGPDMQTHHSTGANHQMVEVNRPNMNQITCGISSPLITGFNGNCVPVSANIPMTSQ
DLFNATHFSTLPQPFLQPPPDQSHMHRYSMSNVASFGQSNPYPCGVVMSSGSMAVAQNSI
PWNNPNPMQGLDPTVTSYHSNLQPMQQTPLPKRQLHHPLWNTNFQSAPNNRDNLPQVSQQ
LSNHGSRQHRGQHSQNLYPGQLQNQDRLLPNLTQQAMALAAPVMHVPSKQVNEDCGQTSS
NTVLRWIPFMFHARHCKAKKDKCASKFCFQARKIVKHIDCCKVPNCKYRYCLGTRMWLDH
FKQCKSISCRTCVAVREYMEKNKYTIVPLRRAKCSSASSKCQPKKSSKSRQAYKKGGAEA
PSVDADLQRSIKRPKLHRPSQNITPETKSISVTGCGVVCKPHSLMNMQEKDGLQSLKVEA
MPMDIDVPGASEIPVTRELVKHVAEDTPKGNNCGGFAMVEKTSCLLAQGKSKCMNEMSAP
KEENVKQSVEVVDASKMEISSLVELFTPEQVKEHIRSLRQWVGQSKTKAEKNKAMGCSMS
VNSCQLCAVEWLVFEPVPIYCSPCGIRIKKNALHYSIAVGESRHYVCAPCYNEAREKLVF
LDGTSIPKTRLQKKKNDEQVPEGWVQCDKCEAWQHIICALFNSRRNHGESTKYTCPSCYI
QEVEQRERRPLPLSAVPGATSLPVTSLSKHLEERLFKKLKEERQERARLQGKTYEEVPGA
ESLTVRVVASVDKVLEVKERFLELFREENYPSEFPYKSKAIFLFQKIENVEVCLFGMFVQ
EFGTDSGPPNERRTFRTVSGEALRTFVYHEILIGYLDYCKKRGFTSCYIWACPPLKGDDY
ILYCHPEIQKTPKTDKLREWYLAMLRKASKEDVVVECTNLYNHFFVQSGECRANVTAARL
PYFDGDYWPSAAEDLLRQMNQEDDGETKLHRKGLTKKVISKRALKAVGQLDLSLNASKDR
LMMQKLGETICPMKEDFIMVHLQHCCKHCTTLMVSGNRWVCNHCKNFQICDKCYEVEQNR
INIERHPINQKEKHALFPVAIKDVPTKIEDKDNNLESEFFHNRQAFLNLCQGNNYQYETL
RRAKHSSMMILYHLHNPTAPAFATVCTICQQEVENSQGWHCEVCPGYDVCSACYSKDSIN
HSHKLTSRSSSTDSTVVQQNGQASQSYQVKLEKLKKLLVHAATCRSTQCQYQGCRKSKML
FRHCIDCTTGDCPICKGLWSLLKLHARNCRDSKCTVPKCSGLRAISRRKQQQADKRRRAA
VMEMMRERAAEATRTG
NT seq 4371 nt NT seq  +upstreamnt  +downstreamnt
atgaataataataaagaagttcctcagaactctgttgctgtttcttcgtcatcgtcggca
ccaataactgttatttctcctcagcaggatgctaataatttcataaagaagagacgcact
gctttaagaaatagaatttatgctatcgtaagacacaagcagaagcagcatcaaatcttt
ctagacaagaagaatcagcagcaacagcagcgtgttgatgatgccacgcaacgtgctctc
ttagagaagcaggatcaacagtgtattgcggcaacaagaatgattgaggaagaactcctc
aagtcttctcgatcatttgaggagtacttcgatttaagaacttttgacgcccgtgtacga
actatattgcaacagcttggaacaatgctttctcagcggcgtgctgctgctgctgccatg
aataacggagaggctcaatgtattacatctacccgagcggtccatacttccataagcgtt
agtaactctttccaatgcggaagaagccttgtgccaattaattgcaccactgcaacagct
ggagcattttctattgggcctgacatgcagacacaccattctactggtgctaatcaccag
atggttgaagttaataggccgaatatgaaccaaattacttgtgggatctctagtcctctg
attactggatttaacggcaactgtgtaccagtttctgctaatatacccatgacttctcaa
gacctcttcaatgctacacatttttcaactttacctcaaccttttctgcaaccaccacct
gatcagtcacacatgcatagatactcaatgagcaacgttgcttcttttggtcaaagtaat
ccatatccctgtggagttgttatgtcatctggctcaatggcagttgctcagaattcaatt
ccatggaacaaccccaatcctatgcagggacttgaccctaccgtcacaagttatcactca
aacctgcaaccaatgcaacaaaccccattgcctaaacgtcaactacatcatcccctgtgg
aataccaatttccaatctgctcccaataacagagacaatttgcctcaggtcagtcaacaa
ctctcaaatcatgggtctcgccagcaccgaggacaacactcccaaaatctttatcctggc
caactccagaaccaagatcgtttacttcccaatctgactcagcaagctatggctttagct
gctcctgtcatgcatgtaccaagtaaacaggttaatgaagattgtggtcaaacgtcttcg
aacaccgttctgcggtggattccgtttatgttccatgcacgtcattgcaaggctaagaaa
gataagtgtgcgagcaagttttgctttcaagccagaaagatagtgaaacatatagactgc
tgcaaggtccctaactgcaaatataggtattgtcttggtactcggatgtggttagatcat
ttcaagcaatgcaaaagcatatcgtgccgtacctgtgtagctgtcagagaatacatggaa
aagaataaatacacaattgtacctctccgtagagctaagtgtagctcagctagttcaaaa
tgtcaacccaagaaatcctcaaaatccaggcaagcatataaaaaaggaggtgctgaagct
ccatctgttgatgctgatctgcaacgctcaatcaagcgcccgaaactacatcgaccctcc
caaaatatcactcccgagacaaagagcatttcggtgacaggatgtggtgttgtctgtaaa
cctcattccttaatgaatatgcaagagaaagatggtttgcaaagcctcaaagttgaggct
atgcctatggacattgatgttcctggtgcttctgagattcccgttaccagggagctggtg
aaacatgttgctgaagatactcccaagggtaataattgtggtggttttgctatggttgaa
aaaactagttgcttattggcacaagggaaatccaaatgtatgaatgaaatgagtgcacca
aaggaagagaatgtgaaacagtctgtggaagttgtagatgcgtctaagatggaaatctcc
tcacttgttgaattgtttactcctgagcaagtaaaggagcatatccgcagtcttcgtcag
tgggtaggacagagtaaaaccaaggcagaaaaaaacaaagcaatggggtgctccatgtct
gtgaattcttgtcagttatgtgctgttgagtggcttgtatttgagccagtacctatttac
tgctcaccttgtggtatacgcatcaagaaaaatgccttgcactatagtattgcggttggt
gagtcaaggcactatgtctgtgcaccttgctacaatgaagcgcgtgaaaaattggttttt
cttgatggaacttctataccgaaaacaaggcttcagaaaaagaaaaatgatgaacaagtt
ccggaagggtgggtgcaatgtgataagtgtgaagcatggcagcatataatttgtgctttg
ttcaacagccgaagaaatcatggagaatccaccaagtacacttgccctagttgctatata
caagaggtggaacaaagagaaagaagaccattaccactaagtgctgttccgggggcaaca
agtttaccagttacttctcttagcaagcatctagaggagcggttattcaaaaagttgaag
gaggaaagacaagagagggctagacttcaaggaaaaacttatgaggaggtcccaggagct
gaatcacttactgtcagagttgtggcatcggttgataaagtattagaagtaaaggaacgt
ttccttgagcttttccgtgaagaaaattatccatctgaattcccttataagtccaaggcc
atttttctgtttcagaagattgaaaatgtggaagtatgcttgtttggtatgttcgttcag
gaatttgggacagactctggacctcccaatgagcggcggacctttcgaactgtgtctgga
gaagcccttcgcacctttgtgtaccatgaaattctgattggttatctcgattattgtaag
aaacgtggttttacaagctgctatatatgggcatgtcctccacttaagggtgacgattac
attctttactgtcatcctgaaatccagaagactccaaagaccgacaaactaagggaatgg
tatttggcaatgttaagaaaagcttcaaaagaagatgtggtcgttgaatgcacaaacctc
tacaatcatttttttgtccagtctggtgaatgtagagctaatgtaactgctgcaaggttg
ccatattttgatggagattactggccaagtgctgctgaggatttactacgccaaatgaac
caagaagatgatggtgagacaaagttacatagaaaaggattgaccaaaaaggtcatatcg
aaaagagccctaaaagccgttggccagttggacctttctcttaatgcctccaaggatcga
cttatgatgcaaaaactcggtgagaccatttgtccgatgaaggaagattttataatggtt
catttgcaacattgctgcaagcattgtaccactctcatggtatctggaaaccggtgggtc
tgcaatcactgcaagaattttcagatctgtgacaagtgttacgaagtggaacagaaccgc
ataaatatagagagacatccgattaatcagaaagagaaacacgcgctatttcctgtggcc
atcaaagacgttcccaccaagattgaagacaaagataacaacctcgagagcgaatttttc
cataatagacaagctttcctgaatctttgccaaggaaataactatcagtacgagactctc
aggcgggcgaaacattcttccatgatgattctctatcatctccacaaccccactgcccct
gcatttgcgacggtttgcaccatctgccaacaagaagttgaaaactctcaaggctggcac
tgtgaagtttgtccgggctatgatgtctgcagtgcctgttactcaaaggactctataaac
cattcacataaactgacaagccgttcatcttctacggatagtactgttgtacaacagaac
gggcaagctagtcagagttatcaagtcaagcttgagaagttaaaaaaactgctagtacat
gcagctacatgccgctctacacagtgccaatatcaaggttgtcgtaagagtaagatgctc
ttcagacattgtatagactgtacgactggagattgccccatttgtaagggattgtggagt
ctcctcaaactccatgcccgcaactgtagagattccaagtgcactgtccccaaatgcagc
ggtttgagagcgattagtagaaggaagcagcagcaggcagacaaaaggcgtagagctgct
gtaatggagatgatgcgggaaagggccgctgaagccacccgcactggctga

DBGET integrated database retrieval system