KEGG   Arabidopsis thaliana (thale cress): AT1G77720Help
Entry
AT1G77720         CDS       T00041                                 

Gene name
PPK1
Definition
putative protein kinase 1
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AT1G77720 (PPK1)
Protein kinases [BR:ath01001]
 Serine/threonine protein kinases: Other group
  TTK family
   AT1G77720 (PPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 777 aa AA seqDB search
MDREDNLPVQPDKPPKSLVRPILNLETTSSSSSSSSSSPELLRHLQAAFKRHRPLSKMQT
TSIGPRRSVAPQRQASRNTRLVTAEGQRSQDVVTLSQSLAANTLTQDTTNNLAITSVAGE
SASITQPTVSEHFNPSDRQMDFGKSAVTSLESNLDVQRKSQSLIGTSQDMEWDATNQAEA
SHLDACIGSKHQNLPSVDSEVSLKSEYKDSSSLAKIQGQLGEFPNFLNQPRTRCSAVGSS
WATTTLIHSSSAPMLNATTHVSRSYVEADSNANPHAVQSQGNLPSCCPSSKVSNILHPNK
DATASEMPASTNDPEVRVKETDTSKQQQITTGLEAPVGSSIYGSDGQANARLPEELHTSV
SSQPQKSDKHEKVASSKGPSAPRKRNYDPDLFFKVNGKLYQRLGKIGSGGSSEVHKVISS
DCTIYALKKIKLKGRDYATAYGFCQEIGYLKKLKGKTNIIQLIDYEVTDKTLLQEVLNGT
MSNKDGRVKEDGFIYMVLEYGEIDLAHMLSQKWREIEGSDRTIDENWLRFYWQQILQAVN
TIHEERIVHSDLKPANFLLVRGFLKLIDFGIAKAINSDTTNIQRDSQVGTLSYMSPEAFM
CNESDENGNTIKCGRPSDIWSLGCILYQMVYGRTPFADYKTFWAKFKVITDPNHEITYNQ
LSNPWLIDLMKKCLAWDRNQRWRIPELLQHPFLAPPIPHEPQVKTIKLFSLIAESCGSDD
DKANSMISQLEQLLSNPAPLPRNDVLDSRDQNQQLLSRVSELCIQLQDRLQGLEGEN
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggacagggaggataaccttccggttcaaccggataaacctccgaagagtctggttcgt
cccattttaaacctggaaacaacttcgtcttcttcatcctcttcctcctcctcaccggaa
cttctacggcatttgcaagccgctttcaaacgccatcgcccactcagtaaaatgcagacg
accagtatcgggcctcgacgaagtgttgctccacaaagacaagcttcaagaaatacacga
ttggttacagctgaagggcagagatctcaggatgttgttacgctgagtcagagtcttgct
gccaatactttgacacaggatactactaacaacttagccatcacttctgttgctggagaa
tctgcgtccattacgcaacctacagtttcagagcatttcaatccatcagatagacagatg
gattttggaaaatctgctgttactagtctagaaagcaatctggatgtccagagaaagtcc
caatctctcattggcacatctcaagatatggaatgggatgcaacaaatcaggctgaagca
tcacatcttgatgcttgtattggatcaaaacatcagaatctcccatctgttgattctgag
gtcagtttaaaatctgaatacaaggattcatcttcactggcaaagatccagggtcagctg
ggagaatttcccaacttcttgaaccaaccaagaactcggtgttcggctgtggggtcatca
tgggccacaactacgctaatccattcatcttcagctcctatgttaaatgctactacccat
gtctctcgttcttatgttgaagctgattcgaatgcaaatcctcatgctgttcaaagtcaa
gggaacttgccttcttgttgtccgtcttccaaggtcagcaacatactacatcccaataag
gatgccactgcgtctgagatgccagcttcaactaatgatccagaagtaagagtcaaagag
acagatacgtccaagcagcaacagatcaccacaggacttgaagctccagtgggatcttcc
atttatgggagcgacggacaagcgaatgctcgtctgcccgaggagttgcataccagtgtt
agctcacagccacaaaaatcagataagcatgaaaaggttgcaagtagcaaagggccatca
gcgcctcgtaaaagaaattatgatccagacttgttctttaaagtcaatgggaagctgtat
cagaggcttggcaagataggaagtggaggaagcagtgaagtccacaaggttatttcttca
gattgtaccatatatgcgctaaaaaagatcaagctcaagggtcgtgactatgctacagca
tatggattttgccaggaaattggatatctaaaaaaactgaaagggaaaaccaacatcatt
cagcttatagactatgaggtcacggataagactttactccaggaggttttgaatggcaca
atgagtaacaaagatggaagagttaaggaagatggatttatatatatggtactagaatat
ggagaaatcgatctggctcacatgttatcccaaaaatggagggaaatcgaaggatctgac
cggacaattgatgaaaattggcttcggttctactggcagcaaatacttcaagctgtgaac
accatacatgaggagcgtattgtgcactctgatttgaaacctgcaaatttccttcttgtt
cgaggctttctaaaacttattgattttggtatcgctaaggccatcaatagcgacactaca
aatattcaacgagattcacaggtggggactttgagttacatgtcaccagaagcattcatg
tgtaacgaaagcgacgagaatgggaacactataaaatgtggaagaccatcagatatttgg
tcacttggttgcatactataccaaatggtatatggaagaacaccttttgcagattataag
accttctgggcaaagttcaaagtcataactgatccaaaccacgagattacttacaatcaa
ctctcaaacccatggcttatcgacctaatgaagaaatgtctagcttgggaccgtaaccaa
agatggagaatccctgagcttctccaacatcctttccttgcgccacccatcccacacgag
cctcaagtgaaaaccattaaattgttcagtctcatagctgaatcttgtggtagtgatgac
gataaagcaaattccatgatttctcagcttgagcaactgctttcaaatcctgctcctctt
ccaagaaatgatgtgttagattcaagagatcaaaatcagcaacttctctctcgagtttca
gaactttgtattcaactccaggatcggttacaaggtcttgaaggagaaaattag

DBGET integrated database retrieval system