KEGG   Arabidopsis thaliana (thale cress): AT2G35940Help
Entry
AT2G35940         CDS       T00041                                 

Gene name
BLH1
Definition
(RefSeq) BEL1-like homeodomain 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 680 aa AA seqDB search
MAAYFHGNPPEISAGSDGGLQTLILMNPTTYVQYTQQDNDSNNNNNSNNSNNNNTNTNTN
NNNSSFVFLDSHAPQPNASQQFVGIPLSGHEAASITAADNISVLHGYPPRVQYSLYGSHQ
VDPTHQQAACETPRAQQGLSLTLSSQQQQQQQHHQQHQPIHVGFGSGHGEDIRVGSGSTG
SGVTNGIANLVSSKYLKAAQELLDEVVNADSDDMNAKSQLFSSKKGSCGNDKPVGESSAG
AGGEGSGGGAEAAGKRPVELGTAERQEIQMKKAKLSNMLHEVEQRYRQYHQQMQMVISSF
EQAAGIGSAKSYTSLALKTISRQFRCLKEAIAGQIKAANKSLGEEDSVSGVGRFEGSRLK
FVDHHLRQQRALQQLGMIQHPSNNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKHM
LAKQTGLTRSQVSNWFINARVRLWKPMVEEMYMEEMKEQAKNMGSMEKTPLDQSNEDSAS
KSTSNQEKSPMADTNYHMNPNHNGDLEGVTGMQGSPKRLRTSDETMMQPINADFSSNEKL
TMKILEERQGIRSDGGYPFMGNFGQYQMDEMSRFDVVSDQELMAQRYSGNNNGVSLTLGL
PHCDSLSSTHHQGFMQTHHGIPIGRRVKIGETEEYGPATINGGSSTTTAHSSAAAAAAYN
GMNIQNQKRYVAQLLPDFVA
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttactttcacggaaacccaccggagatctctgccggatccgacggtggtctt
caaacgttgatcctcatgaatccaactacttacgttcagtacacccaacaagacaacgac
tcgaacaacaacaacaacagcaacaatagcaacaacaacaacacaaacacaaacacaaac
aacaacaacagtagtttcgttttcctcgattcccacgcgccgcagccaaacgcgagccag
cagttcgtcggaataccactctcaggtcacgaagctgcttccattacagccgccgacaac
atctccgtacttcacggttatcctccgcgcgtgcagtacagtctctacggtagccaccaa
gtggatcccactcaccagcaagccgcgtgtgagacgccacgcgcgcagcaaggcctctct
ttaaccctctcgtctcaacagcagcagcaacagcaacatcatcaacaacaccagcctatt
cacgtcggattcgggtccggacatggagaagatatccgggtcgggtctggctctacagga
tcgggggtaacaaacggtatagctaatcttgttagctccaagtacttgaaggcagcacaa
gagcttcttgacgaagtagtcaacgctgattccgatgacatgaacgctaaatcccaacta
ttctcatcgaaaaagggtagttgcggaaatgataaacctgtcggagaatcatcggccggc
gctggaggagaaggttccggtggcggagcagaagcagccgggaaacgtccggtggagcta
ggcacggcagagagacaagaaatacagatgaagaaagcaaaacttagtaacatgcttcat
gaggtggagcagagatatagacagtaccaccagcagatgcagatggtgatctcttcgttc
gagcaagcggcagggataggatcagcgaagtcatacacgtcgctagcattgaaaaccata
tcaagacagttccgttgcttgaaagaggcgatcgctggtcagataaaagcggccaacaag
agtcttggggaggaagattcagtgtctggtgttgggaggtttgaggggtcgaggctcaag
ttcgtggaccaccacttgagacagcaaagagctcttcaacaactgggaatgattcaacat
ccttccaataatgcttggagacctcaacgtggtctcccagaacgagccgtctcagttctc
cgtgcttggctcttcgaacactttcttcatccataccctaaggattcggacaagcacatg
ctagctaagcaaacaggactcactcgtagccaggtgtcgaactggtttataaacgcgaga
gttcggttatggaaaccaatggtggaggagatgtacatggaggaaatgaaggagcaggca
aagaacatgggatccatggaaaagactcctttggatcaaagcaacgaagattctgcttca
aagtcaacaagtaaccaagaaaagagcccaatggcggacactaattaccatatgaatccc
aatcacaacggtgacctagaaggcgtcactggaatgcaaggaagccccaagagactaaga
accagcgacgagacaatgatgcagccaataaatgcggatttcagctccaacgagaagctc
acgatgaagattctagaagaacggcaagggataagatcagatggtggctaccctttcatg
ggtaatttcgggcaataccaaatggatgagatgtcaagatttgatgtagtctcagaccag
gagctcatggcgcaaaggtactcaggaaacaacaatggcgtgtccctcacgttaggttta
cctcattgtgatagcttgtcgtccacgcaccatcagggtttcatgcagacccaccatggg
attcctatagggagaagagtgaaaataggagaaacagaggaatatggacccgccaccatc
aatggtggtagctcgaccacaaccgcacattcatcagcggcagctgccgcggcttacaat
gggatgaacatacagaaccagaagagatatgtggctcagttattgcccgacttcgttgca
taa

DBGET integrated database retrieval system