KEGG   Arabidopsis thaliana (thale cress): AT3G20330Help
Entry
AT3G20330         CDS       T00041                                 

Gene name
PYRB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AT3G20330 (PYRB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT3G20330 (PYRB)
Enzymes [BR:ath01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     AT3G20330 (PYRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 390 aa AA seqDB search
MSIASSLTSATLCGASVFPKALACSSEFPINLPSPFESSKICLTSFPASRDLKKNATLNL
TRNVGPVRCHAMQAGTRELKKFELSDVIEGKQFDREMLSAIFDVAREMEKIEKSSSQSEI
LKGYLMATLFYEPSTRTRLSFESAMKRLGGEVLTTENAREFSSAAKGETLEDTIRTVEGY
SDIIVMRHFESGAARKAAATANIPVINAGDGPGEHPTQALLDVYTIQSEIGKLDGISVAL
VGDLANGRTVRSLAYLLAKFKDVKIYFVSPEIVKMKDDIKDYLTSSGVEWEESSDLMEVA
SKCDVVYQTRIQRERFGERLDLYEAARGKYIVDKDLLGVMQKKAIIMHPLPRLDEITADV
DADPRAAYFRQAKNGLFIRMALLKLLLVGW
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgcatcatcacttacttcagccacactttgcggcgcctcagtttttcctaaa
gcattagcctgcagctctgagttccctatcaatcttcccagcccttttgaaagttcaaag
atttgtttgacttcgtttcctgcctctagggatctcaagaaaaatgctactttgaatctg
actcgaaatgttggtccagtcaggtgtcatgctatgcaagctgggacgagggagttgaag
aaatttgaacttagtgatgtgattgaagggaaacagtttgatagagagatgctaagcgct
atattcgatgttgcacgcgaaatggaaaagatagaaaagagctcttcacaaagtgaaatc
ctcaagggttatttaatggctaccctcttttatgagccttctacccgtaccaggctttca
tttgaatctgctatgaaacgccttggaggtgaagtcttaactactgagaacgctagagag
ttttcgtctgccgcgaaaggggaaacacttgaagacacaataagaacagtggagggttat
tcagatataattgtgatgcgacattttgaaagcggtgctgcaagaaaagctgcagctact
gccaatatacctgtcattaatgcaggtgatggtcctggagagcatcctactcaggctcta
ttggacgtctataccatccaaagtgaaattggaaaattagatggcatcagtgtagcctta
gttggagaccttgccaacggaaggactgtgcggtctcttgcatacttgcttgccaagttc
aaagacgtgaagatctactttgtttcccctgaaattgtgaaaatgaaggatgatataaaa
gactatttgacatcaagcggggttgaatgggaagaaagttcagatttaatggaagtagca
tccaagtgtgatgtagtttatcaaacacgaatccaaagagagaggtttggagaaaggctg
gacctttacgaagcagctcgtgggaagtatatcgtagacaaggatctgttaggagtgatg
cagaaaaaagctattatcatgcatcctttaccgagattggatgaaatcaccgcagatgtt
gatgctgatccaagagctgcctacttcagacaagcaaagaacggtttgttcattagaatg
gctcttctaaagctactgcttgtcggttggtga

DBGET integrated database retrieval system