KEGG   Arabidopsis thaliana (thale cress): AT3G55440Help
Entry
AT3G55440         CDS       T00041                                 

Gene name
TPI
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT3G55440 (TPI)
   01230 Biosynthesis of amino acids
    AT3G55440 (TPI)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT3G55440 (TPI)
   00051 Fructose and mannose metabolism
    AT3G55440 (TPI)
   00562 Inositol phosphate metabolism
    AT3G55440 (TPI)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AT3G55440 (TPI)
Enzymes [BR:ath01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AT3G55440 (TPI)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AT3G55440 (TPI)
  Exosomal proteins of bladder cancer cells
   AT3G55440 (TPI)
  Exosomal proteins of melanoma cells
   AT3G55440 (TPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 254 aa AA seqDB search
MARKFFVGGNWKCNGTAEEVKKIVNTLNEAQVPSQDVVEVVVSPPYVFLPLVKSTLRSDF
FVAAQNCWVKKGGAFTGEVSAEMLVNLDIPWVILGHSERRAILNESSEFVGDKVAYALAQ
GLKVIACVGETLEEREAGSTMDVVAAQTKAIADRVTNWSNVVIAYEPVWAIGTGKVASPA
QAQEVHDELRKWLAKNVSADVAATTRIIYGGSVNGGNCKELGGQADVDGFLVGGASLKPE
FIDIIKAAEVKKSA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccagaaagttcttcgtcggaggcaactggaaatgtaacggaactgctgaggaggtg
aagaagattgtgaacactcttaatgaagctcaggttccttcacaggatgttgtagaggtt
gtggttagccctccatatgtttttcttcccctggttaagagcacattgaggtctgacttt
tttgttgcggcacaaaactgttgggttaagaaaggaggtgctttcactggtgaagtgagt
gcggagatgcttgtgaacttggatattccatgggttatccttggtcactctgaaaggagg
gcaatccttaatgaatcaagcgagttcgtcggagacaaggttgcctatgcacttgctcaa
ggtttgaaagtgattgcttgtgttggtgagactcttgaggagcgggaagctggatcgacc
atggatgttgtggctgcccagaccaaggctattgccgatcgggtgacaaactggtcaaat
gttgtcatagcctatgaaccagtgtgggccattggaaccggaaaggtcgctagcccagcc
caagctcaagaagtacacgatgagctgaggaaatggctggccaagaacgtgagtgctgat
gtcgctgctacaacccgcatcatttatggaggatccgtcaatggtggtaactgcaaggag
ctaggtggacaggccgatgttgatggtttcttggtcggtggtgcttctctaaagcctgag
tttatcgacatcattaaggccgcagaggtgaagaaaagtgcctaa

DBGET integrated database retrieval system