KEGG   Arabidopsis thaliana (thale cress): AT3G55440Help
Entry
AT3G55440         CDS       T00041                                 

Gene name
TPI
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:ath01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ath01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ath00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ath00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ath00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:ath00710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 254 aa AA seqDB search
MARKFFVGGNWKCNGTAEEVKKIVNTLNEAQVPSQDVVEVVVSPPYVFLPLVKSTLRSDF
FVAAQNCWVKKGGAFTGEVSAEMLVNLDIPWVILGHSERRAILNESSEFVGDKVAYALAQ
GLKVIACVGETLEEREAGSTMDVVAAQTKAIADRVTNWSNVVIAYEPVWAIGTGKVASPA
QAQEVHDELRKWLAKNVSADVAATTRIIYGGSVNGGNCKELGGQADVDGFLVGGASLKPE
FIDIIKAAEVKKSA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccagaaagttcttcgtcggaggcaactggaaatgtaacggaactgctgaggaggtg
aagaagattgtgaacactcttaatgaagctcaggttccttcacaggatgttgtagaggtt
gtggttagccctccatatgtttttcttcccctggttaagagcacattgaggtctgacttt
tttgttgcggcacaaaactgttgggttaagaaaggaggtgctttcactggtgaagtgagt
gcggagatgcttgtgaacttggatattccatgggttatccttggtcactctgaaaggagg
gcaatccttaatgaatcaagcgagttcgtcggagacaaggttgcctatgcacttgctcaa
ggtttgaaagtgattgcttgtgttggtgagactcttgaggagcgggaagctggatcgacc
atggatgttgtggctgcccagaccaaggctattgccgatcgggtgacaaactggtcaaat
gttgtcatagcctatgaaccagtgtgggccattggaaccggaaaggtcgctagcccagcc
caagctcaagaagtacacgatgagctgaggaaatggctggccaagaacgtgagtgctgat
gtcgctgctacaacccgcatcatttatggaggatccgtcaatggtggtaactgcaaggag
ctaggtggacaggccgatgttgatggtttcttggtcggtggtgcttctctaaagcctgag
tttatcgacatcattaaggccgcagaggtgaagaaaagtgcctaa

DBGET integrated database retrieval system