KEGG   Arabidopsis thaliana (thale cress): AT3G55940Help
Entry
AT3G55940         CDS       T00041                                 

Definition
(RefSeq) Phosphoinositide-specific phospholipase C family protein
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00562  Inositol phosphate metabolism
ath01100  Metabolic pathways
ath04070  Phosphatidylinositol signaling system
ath04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AT3G55940
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    AT3G55940
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    AT3G55940
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     AT3G55940
Membrane trafficking [BR:ath04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    AT3G55940
 Endocytosis
  Macropinocytosis
   Phospholipase C
    AT3G55940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 EF-hand_like DUF2264
Motif
Other DBs
NCBI-GeneID: 824760
NCBI-ProteinID: NP_191153
MIPS: AT3G55940.1
TAIR: AT3G55940
Araport: AT3G55940
UniProt: Q9LY51
Position
3
AA seq 584 aa AA seqDB search
MSKQTYKVCFCFRRRYRHTVSVAPAEIKTLFDNYSDKGLMTTDLLLRFLIDVQKQDKATK
EEAQDIVNASSSLLHRNGLHLDAFFKYLFAVTNSPLSSLEVHQDMDAPLSHYFIYTGHNS
YLTGNQLSSDCSELPIIEALKKGVRVIELDIWPNSDEDGIDVLHGRTLTSPVELIKCLRA
IREHAFDVSDYPVVVTLEDHLTPKLQAKVAEMVTDIFGEMLFTPPSGECLKEFPSPAFLK
KRIMISTKPPKEYKAATDDDLVKKGRDLGDKEVWGREVPSFIRRDRSVDKNDSNGDDDDD
DDDDDDDDDGDDKIKKNAPPEYKHLIAIEAGKPKGGITECLKVDPDKVRRLSLSEEQLEK
ASEKYAKQIVRFTQRNLLRVYPKGTRITSSNYNPLIAWSHGAQMVAFNMQGLGRSLWVMQ
GMFRGNGGCGYIKKPDLLLKSNAVFDPEATLPVKTTLRVTIYMGEGWYYDFPHTHFDRYS
PPDFYTRVGIAGVPADTVMKKTKTLEDNWIPAWDEVFEFPLTVPELALLRIEVHEYDMSE
KDDFGGQICLPVWELRQGIRAVPLRNQDGVKCRSVKLLVRLEFV
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcaaacatacaaagtctgtttctgtttccgtcggaggtaccgacacactgtg
tccgtagctcctgctgagatcaaaacacttttcgacaattactccgacaaaggtctcatg
actaccgatctcctcctcagattcctaatcgatgttcagaaacaagacaaagccacgaaa
gaagaagctcaagatatcgtcaatgcttcttcttctcttcttcatcgtaatggtctccac
cttgatgctttcttcaaataccttttcgctgttaccaactctcctctttcttctcttgag
gtgcatcaagatatggatgctccattatcacattatttcatatatacaggacataattcg
tatttaacaggtaatcaactaagtagtgattgcagtgaattgcctatcattgaggcattg
aaaaaaggtgttagagttattgaattagatatttggcctaactctgatgaagatggtatc
gatgttcttcatggaaggactcttacatcacctgtggagctgataaaatgtctaagagct
attagagaacatgcttttgatgtatctgattatccagttgttgttactcttgaagatcat
cttactcctaaactccaagctaaagttgctgagatggttacagatatatttggagaaatg
ttgtttactcctccttcaggggaatgtttgaaggagtttccatcgccggcgtttttgaaa
aagcgtattatgatctcaactaaacctcctaaagagtataaggcagcaacagatgatgat
ttggtgaaaaaaggaagggatttgggtgataaagaagtttggggaagagaagttccaagc
tttattcgaagggacagaagtgttgacaagaatgattcaaacggagatgatgatgatgat
gatgacgatgacgatgatgatgatgatggtgatgataagattaagaagaatgcaccaccg
gaatataagcatctgattgcaatcgaggctgggaaaccgaaaggcggaataactgaatgt
ttgaaggtggatcctgataaagtaagacggcttagcttaagtgaagaacaacttgaaaag
gcctcagaaaaatatgctaaacagattgtgaggttcactcagaggaatttgctacgggtt
tatccgaaaggaactagaattacttcatcaaactataaccctctgatcgcttggagccat
ggagctcaaatggtggctttcaatatgcagggacttggacgatcattgtgggtaatgcaa
ggaatgtttagaggcaatggaggatgtggctacattaagaaacctgatcttttgctgaaa
tccaacgctgtatttgacccggaagctacattacctgtaaaaacaacactaagggtaact
atatacatgggagaaggatggtactacgatttcccgcatacgcactttgatcgatattct
ccacctgatttctatacaagggtcgggattgctggagttcccgcggatacagtaatgaag
aagacgaaaacattagaggataattggataccagcttgggacgaggtttttgagttccca
ttaacagttccagagcttgctcttctacgtatcgaggtacatgagtatgacatgtctgag
aaagacgattttggaggccaaatttgcttgccggtttgggagctgaggcaaggaatacgt
gccgttcctctccgtaaccaggatggtgtcaagtgtagatccgtgaagcttcttgtgcgg
ttggagtttgtgtga

DBGET integrated database retrieval system