KEGG   Arabidopsis thaliana (thale cress): AT3G62920Help
Entry
AT3G62920         CDS       T00041                                 

Definition
(RefSeq) hypothetical protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 80 aa AA seqDB search
MSIYRIARALPFSGILRQLEKEAETVINVLQPGPLGIIEHKFSAQEIREAKATVSRAVDS
WRRHSEVEHANGLLKDYIYK
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatttacaggatcgctagagctttacccttctccgggatcttaaggcagcttgag
aaagaagctgaaactgtgatcaatgttctgcaacctggacctttgggaatcatagagcac
aagttctcggctcaagagattcgggaagcaaaagctacagtttctagagctgttgatagt
tggcgaagacattctgaggtcgagcatgcaaatggccttttaaaagattacatttacaag
tga

DBGET integrated database retrieval system