KEGG   Arabidopsis thaliana (thale cress): AT4G17615Help
Entry
AT4G17615         CDS       T00041                                 

Gene name
CBL1
Definition
calcineurin B-like protein 1
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Protein phosphatases and associated proteins [BR:ath01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     AT4G17615 (CBL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 213 aa AA seqDB search
MGCFHSKAAKEFRGHEDPVKLASETAFSVSEVEALFELFKSISSSVVDDGLINKEEFQLA
LFKSRKRENIFANRIFDMFDVKRKGVIDFGDFVRSLNVFHPNASLEDKIDFTFRLYDMDC
TGYIERQEVKQMLIALLCESEMKLADETIEIILDKTFEDADVNQDGKIDKLEWSDFVNKN
PSLLKIMTLPYLRDITTTFPSFVFHSEVDEIAT
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcttccactcaaaggcagcaaaagaatttcgaggacacgaagaccctgttaag
cttgcctctgagacagcttttagtgtgagtgaggttgaagcattatttgagctattcaag
agcataagcagttcggttgttgatgatggtctgattaacaaggaggagtttcaacttgct
ttgttcaaaagccggaagagggagaatatatttgctaataggatatttgatatgtttgat
gttaaacgaaaaggagtcatcgatttcggggactttgtaagatcactcaatgttttccac
cccaatgcttctctagaagacaaaatagattttacgtttaggctttacgacatggactgc
acgggttacattgaacgacaagaggtcaagcaaatgttgatcgcgcttctctgcgaatct
gaaatgaaactggctgatgaaaccatagagataatactcgataagacatttgaagatgca
gacgtgaatcaagatggaaaaattgataaattagagtggagtgatttcgtaaacaaaaat
ccatcattgcttaagatcatgactcttccatatctcagggatattacgacaacgtttccg
agttttgtcttccattcggaggtcgatgagattgccacatga

DBGET integrated database retrieval system