KEGG   Arabidopsis thaliana (thale cress): AT4G29340Help
Entry
AT4G29340         CDS       T00041                                 

Gene name
PRF4
Definition
profilin 4
Orthology
K05759  
profilin
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Exosome [BR:ath04147]
 Exosomal proteins
  Proteins found in most exosomes
   AT4G29340 (PRF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 134 aa AA seqDB search
MSWQTYVDEHLMCDVGDGQGHHLTAAAIVGHDGSVWAQSANFPQFKGQEFSDIMKDFDEP
GHLAPTGLFMAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQSCVFGIYEEPVTPGQCNM
VVERLGDYLLEQGL
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaaacttacgttgatgagcatttgatgtgtgatgttggcgatggtcaagga
caccaccttactgctgccgctatcgttggtcatgacggtagcgtttgggctcagagcgcc
aacttccctcagttcaagggacaggagttcagtgatattatgaaagatttcgacgaaccg
ggtcacttggcacccacgggattattcatggcaggagcaaagtacatggtgatccaaggt
gagcccggggctgtaatccgtggcaagaagggagcaggaggcataacgataaagaaaaca
ggacagtcatgtgtgtttgggatctatgaagagccagtgacaccaggacagtgcaacatg
gtcgtcgagaggttgggtgattacctcctcgaacagggtctctag

DBGET integrated database retrieval system