KEGG   Arabidopsis thaliana (thale cress): AT5G01840Help
Entry
AT5G01840         CDS       T00041                                 

Gene name
OFP1
Definition
(RefSeq) ovate family protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Ovate DNA_binding_2 DUF966
Motif
Other DBs
NCBI-GeneID: 831813
NCBI-ProteinID: NP_195804
MIPS: AT5G01840.1
TAIR: AT5G01840
Araport: AT5G01840
UniProt: Q9LZW2
Position
5
AA seq 270 aa AA seqDB search
MGNNYRFKLSELIPNAWFYKLRDMSKSKKKNLQSQPNSTTSKKKHHAVPTPTSTTPLSPR
PPRRPSHSSKAPPSHPPRKSSGNRLRHRATVDSKSSTTSGDSTTTETGSFSPDFRSDQVL
LPDESLTGSWHSPCSSKLSKTATFTPPPELELRPIITKTAATARKTAVNSPAGVRLRMRS
PRISVSSSARRSGSSARRSRAVVKASVDPKRDFKESMEEMIAENKIRATKDLEELLACYL
CLNSDEYHAIIINVFKQIWLDLNLPPPHSK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggtaataactatcggtttaagctatcggagttaatccctaacgcttggttttacaaa
cttagagacatgtccaaatccaagaagaagaatcttcagagccaaccaaatagcaccacc
tccaagaagaaacaccacgcagtccctactcctacgtccacaacgccactcagtcctagg
cctcctaggcgcccttctcactcttccaaagcgccaccctcccatcctcccaggaagtcc
tccgggaaccgtcttcgtcaccgagccaccgtcgactctaagtcttccacgacttccggc
gacagcactaccacagaaacaggttctttctcaccggactttcgctcggatcaagttctc
ctccccgacgagtcattaacgggctcctggcacagcccttgcagctccaagttatccaaa
accgcaacctttacgccgccgccggaactcgaactccggcccatcattaccaaaacggcc
gccaccgcacggaaaacggcggtgaattctccggcgggggtgagacttagaatgcggtcg
ccgcggatctcggtgagcagcagcgcaagaagaagcgggtcgtcggctcggcggagcagg
gcggtggtgaaggcgtcggtggatccgaagagagactttaaggagtcgatggaggagatg
atcgctgagaacaagataagagcgacaaaggatctagaggagcttttggcttgctatctc
tgtctcaattcagacgaatatcacgctattatcatcaatgtcttcaagcaaatctggctt
gatcttaatcttccaccaccccattccaaataa

DBGET integrated database retrieval system