KEGG   Arabidopsis thaliana (thale cress): AT5G16710Help
Entry
AT5G16710         CDS       T00041                                 

Gene name
DHAR3
Definition
(RefSeq) dehydroascorbate reductase 1
  KO
K21888  
glutathione dehydrogenase/transferase [EC:1.8.5.1 2.5.1.18]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Ascorbate and aldarate metabolism
Glutathione metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    AT5G16710 (DHAR3)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AT5G16710 (DHAR3)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.5  With a quinone or similar compound as acceptor
    1.8.5.1  glutathione dehydrogenase (ascorbate)
     AT5G16710 (DHAR3)
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AT5G16710 (DHAR3)
Transporters [BR:ath02000]
 Other Transporters
  Pores ion channels [TC:1]
   AT5G16710 (DHAR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
5
AA seq 258 aa AA seqDB search
MISLRFQPSTTAGVLSASVSRAGFIKRCGSTKPGRVGRFVTMATAASPLEICVKASITTP
NKLGDCPFCQKVLLTMEEKNVPYDMKMVDLSNKPEWFLKISPEGKVPVVKFDEKWVPDSD
VITQALEEKYPEPPLATPPEKASVGSKIFSTFVGFLKSKDSGDGTEQVLLDELTTFNDYI
KDNGPFINGEKISAADLSLAPKLYHMKIALGHYKNWSVPDSLPFVKSYMENVFSRESFTN
TRAETEDVIAGWRPKVMG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgataagccttaggtttcaaccaagcaccaccgccggtgttttatcggcgtcagtgagc
cgcgccggttttatcaagcggtgcggttcgactaaaccgggaagggttggccggtttgtt
acaatggcgacggcggcgagtcctcttgaaatctgcgttaaagcttctatcaccactccc
aacaagctcggagactgccctttttgccaaaaggtgttactgacaatggaggagaagaat
gttccttatgacatgaaaatggtggatttgagtaacaaaccagaatggttcttgaagatt
agtccagaaggtaaagtcccagttgtgaagtttgatgagaaatgggttccggattcagat
gttataacacaggctttagaagagaagtatcctgagcctcctcttgctaccccacctgaa
aaggcttcagttggatcgaagatcttttccacatttgtcggttttctgaagagcaaagat
tcaggagatggaactgagcaagttttgttggatgagcttactacattcaacgattatatc
aaggacaatggccctttcataaatggagagaagatctcggcagcagatttgtccttggca
ccaaagttataccacatgaagattgcattgggacattacaagaactggtctgttccagat
tcacttcctttcgtcaaatcctacatggagaatgttttctcgagggaatcattcacgaac
acacgggcggaaacagaggatgtaattgctggttggagaccaaaggttatgggttaa

DBGET integrated database retrieval system