KEGG   Arabidopsis thaliana (thale cress): AT5G24320Help
Entry
AT5G24320         CDS       T00041                                 

Definition
(RefSeq) transducin/WD40 domain-containing protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 698 aa AA seqDB search
MESLIEEEEESRFFDAHEEIASCSSPCKIESPSSISGEFRYDVWIKSPGNTEERREKFLK
WMGLSSTVNESKSGNVYRLSSSVNESAVLMSLKSDDDEFSSSRCDSFSPSESVDRVVNES
LCKEEGEVDSGMVLRNLGFVDDGDISSSLCSLSSSPVSDKIVKEHGEPKLLPDPMVAEEE
REVSGIMKRVKEKWLSRLYKVRNKRSAGGDDNGGEVAVCGSRIERVKVKEYKKEAKELSA
LFKGQEIQAHEGAILAMKFSPDGRYLASAGEDGVLRVWSVVEDERCEEHDVPKIDPSCIY
FEVSKLSELRPVAVEKDGITGSLMSPRKTTESACVIIPPKIFRVLDKPLHEFLGHSGDIL
DISWSKNNRLLSASVDNSVRLWQIGCEDCLGIFSHNNYVTSVQFNPVDDDHFISGSIDGK
VRIWSASQCQVVDWADARGIVTAVCYQPDGQAVIIGTLTSDCRFYNVSGHCLQLDGHICL
HNKKKSSNKRIIGFQFLLQFDSTDPSRVMVASADSQVRIISGRNVVHKYKGSRNAGNQIS
ASFTADGKHIVSACDDSSVYVWNCVGHDPEQSSPGFFSHTKRLKIRSFEKFSADVSVAIP
WCGFTPVLSGGSELSPSLFSLGREYVLDSPKGSATWPEEKLASSFSPVKAIRRSHYKFLR
SSCRRTSESSHLWGLVIVTGGWDGRIKLFHNYGLPVPV
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggaatcactaattgaagaagaagaagagtctcgatttttcgatgctcacgaagaaatc
gcatcttgttcaagtccttgtaaaatcgaatctccatcgtcgatttctggagaatttcgt
tacgatgtttggatcaaaagccctggtaacactgaggagcgtcgtgagaagtttttgaag
tggatgggtttaagtagtactgtaaacgaatcgaaatcaggtaatgtgtatcggttatcg
agctcggttaacgaatcagcggttttgatgagtttgaaatctgatgacgatgagtttagc
tcttctcgttgtgattcttttagtccaagtgagagtgtagatagagttgtgaatgagagt
ttgtgtaaagaggaaggagaagtagatagtggtatggttttgaggaatttgggttttgtt
gatgatggtgatattagctctagtctttgttctttatcatcatctcctgtatcggataag
attgtgaaggaacatggtgaacctaagttgttaccagacccgatggttgctgaggaggaa
cgggaagtaagtgggattatgaagagggttaaggagaaatggttgagtcggttgtacaaa
gtgcggaacaagcgaagtgcgggaggagatgataatggcggtgaagttgcggtttgcggg
agtaggattgagagagtgaaggtgaaagagtataaaaaagaggctaaggagctttctgct
ctttttaaaggtcaagagatacaagctcatgaaggagcgattctcgctatgaagtttagt
cctgatgggaggtatcttgcgagtgctggtgaagatggggttttgcgggtttggagtgtt
gttgaagacgaaagatgtgaagaacatgatgttcctaagattgatccttcttgtatatac
tttgaagtgagtaaactctctgagttgagaccggtggctgtagaaaaggatgggattact
ggttcgttgatgagtccaaggaagacaacagagtctgcttgtgttattattcccccaaag
atttttcgggttcttgataaaccgcttcacgagtttctcggtcacagtggtgatatcctt
gatatctcttggtccaagaacaatcgtctgttgtcagcttcagtagacaatagtgttcgg
ctttggcagatcggctgtgaggactgtcttggaatcttctctcacaataactacgttaca
tccgttcagtttaacccggttgatgatgatcacttcatcagtggttccatagatggaaaa
gttcgtatctggtcagcttcacagtgccaagttgtagattgggccgatgctagaggcatt
gtaaccgcagtttgttatcaacctgatgggcaggcagtgattatcggaactttgacaagc
gattgtcgcttctacaatgtatcaggccactgccttcaacttgatggtcatatatgtctg
cacaacaaaaagaagtcgtcgaataaacgaataatcggctttcagtttcttctgcagttt
gattctactgacccaagcagagtcatggtggcatcagcagattcacaagtgaggatcatt
agtggtcgcaacgttgtccacaaatacaaaggatctcgaaatgctggaaaccagatatcg
gcatcttttacagcagacgggaagcatatagtctctgcgtgtgacgattcatcggtctac
gtctggaactgcgttggacacgaccctgaacagtcgtctcctggttttttctctcacacc
aaacgacttaaaatccgatcattcgaaaaattctctgcggatgtttcagtagctatcccg
tggtgcggatttacgcctgtactctccggcggatccgagctatcgccatcgctcttctca
ttagggcgcgagtacgttctcgattctcccaagggatctgccacttggccggaagagaag
ctagcgagctcgttttctccggtgaaagcgatccgtagatcgcattacaaattcctccgg
tcttcgtgccggagaacgtcggagtcatctcatctctggggattggttatagtcaccggt
ggttgggatggacggatcaaattgtttcacaactatggtttgcctgttcccgtttga

DBGET integrated database retrieval system