KEGG   Arabidopsis thaliana (thale cress): AT5G53490Help
Entry
AT5G53490         CDS       T00041                                 

Definition
(RefSeq) Tetratricopeptide repeat (TPR)-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Pentapeptide Pentapeptide_3 Pentapeptide_4
Motif
Other DBs
NCBI-GeneID: 835431
NCBI-ProteinID: NP_851183
MIPS: AT5G53490.1
TAIR: AT5G53490
Araport: AT5G53490
UniProt: P81760 A0A178UI74
Position
5
AA seq 236 aa AA seqDB search
MASLPVQFTRNQISSPFFSVNLRREPRSLVTVHCSAGENRENGEGVKKSLFPLKELGSIA
CAALCACTLTIASPVIAANQRLPPLSTEPDRCEKAFVGNTIGQANGVYDKPLDLRFCDYT
NDQTNLKGKTLSAALMVGAKFDGADMTEVVMSKAYAVEASFKGVNFTNAVIDRVNFGKSN
LKGAVFRNTVLSGSTFEEANLEDVVFEDTIIGYIDLQKICRNESINEEGRLVLGCR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgcttcctgttcaattcacgaggaatcaaatctcttcaccgtttttctctgta
aacctccgccgtgagcctagatctttagtaacagtacactgctccgcaggagaaaacaga
gaaaatggtgaaggtgtaaagaagagtctctttcctcttaaggagcttggatctatcgct
tgcgcagctctctgtgcttgcactcttacaatagcttctcctgttattgctgctaaccag
agacttcctccgttatcaacagaaccagaccggtgtgaaaaagcatttgttggtaacacg
ataggtcaagcaaatggtgtctatgacaaaccactggatcttaggttctgtgattacaca
aatgatcaaactaatctcaaaggcaagactctctctgcagccttgatggttggggctaag
tttgatggtgcagatatgactgaagttgttatgtcaaaagcttatgctgtagaagcaagc
tttaaaggggtgaatttcactaatgctgttatcgatcgggtgaatttcgggaaatcgaat
ctgaaaggtgcggtgtttaggaacacggtattatccggttcgacatttgaggaggcaaat
ttggaggatgtggtctttgaggacactatcattggttacatagaccttcagaaaatatgt
aggaatgagtccataaacgaagaaggaagacttgtgttgggatgccgatag

DBGET integrated database retrieval system