KEGG   Arabidopsis thaliana (thale cress): AT5G55990Help
Entry
AT5G55990         CDS       T00041                                 

Gene name
CBL2
Definition
calcineurin B-like protein 2
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
5
AA seq 226 aa AA seqDB search
MSQCVDGIKHLCTSVLGCFDLDLYKQSGGLGDPELLARDTVFSVSEIEALYELFKKISSA
VIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPI
DDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIEDIIDKTFEEADTKHD
GKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagtgcgttgacggtatcaagcatttatgcacctctgttttagggtgttttgat
cttgatttgtataaacaatctggtggccttggagatcctgaattgcttgcaagagacact
gtttttagtgtgagtgaaatagaagctctttatgagctttttaagaaaatcagcagtgcc
gtgattgatgatgggctaataaacaaggaagagtttcagttggctttgtttaagacaaat
aaaaaagagagtttgtttgcagatcgggttttcgatttgtttgatacaaagcacaatgga
atactggggtttgaggaatttgctcgtgctctctccgtctttcacccaaatgcgcctata
gatgacaaaattcacttttcatttcagctatatgatcttaaacagcaagggtttatcgaa
cggcaagaggtgaaacaaatggttgtcgctacgcttgctgaatctggaatgaatttgaag
gatactgtcattgaggatataatcgacaagacgtttgaggaagcagacacaaaacacgat
ggaaagatcgataaggaagagtggagaagccttgttcttagacatcccagccttctgaag
aacatgactcttcaatatctcaaggatatcacgactacgtttccaagctttgtgttccat
tctcaggttgaagatacctga

DBGET integrated database retrieval system