KEGG   Trichormus variabilis: Ava_1113Help
Entry
Ava_1113          CDS       T00277                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ava  Trichormus variabilis
Pathway
ava00521  Streptomycin biosynthesis
ava00523  Polyketide sugar unit biosynthesis
ava01130  Biosynthesis of antibiotics
Module
ava_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Ava_1113
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ava_1113
Enzymes [BR:ava01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Ava_1113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom TnsD
Motif
Other DBs
NCBI-ProteinID: ABA20737
JGI: Ava1113
CyanoBase: Ava_1113
CYORF: Ava_1113
UniProt: Q3ME49
Position
1356914..1357483
Genome map
AA seq 189 aa AA seqDB search
MIFTATSLQDAFIIDLEEKPDHRGFFARTFCANEFAAHGLKPVVAQCNLSYNYKKGTLRG
MHYQLRPAAETKLIRCIKGAIYDVIIDMRPESPTFLSHIGVELTADNRRALYVPEMFAHG
YQALTDDAEVVYQVGEFYTPGYEKGLRYNDPFFNIEWPLDVTVISDKDANWPLLETIPIG
SPDPVEAVC
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgatttttaccgctacatcactccaggacgcatttattattgatttagaagaaaaacca
gatcatcgtggtttttttgccagaactttttgtgctaatgaatttgcagcccacggttta
aaaccagtagttgctcagtgtaacttatcttataactataaaaaaggtacactgcggggg
atgcactatcaactcagaccagccgccgaaacaaaactaattcgttgtattaagggcgct
atttatgacgtaattattgatatgcgtcccgaatcaccaacatttttatcacatattggt
gtagaactcactgctgataatcgtcgtgctttgtatgtaccagagatgtttgctcatggt
tatcaagccctcaccgatgatgcagaagtggtgtatcaagtaggtgaattttatacccca
ggatatgaaaaaggcctgcgttataatgacccattcttcaacattgaatggcctttagat
gtgactgtaatttctgataaagatgccaattggcctttattagaaactatccccatcggt
agcccagacccagtagaagcagtttgttaa

DBGET integrated database retrieval system